product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human papillomavirus type 16 Regulatory protein E2
catalog :
MBS9421064
quantity :
0.01 mg
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9421064
products type :
Recombinant Protein
products full name :
Recombinant Human papillomavirus type 16 Regulatory protein E2
products short name :
[papillomavirus type 16 Regulatory protein E2]
other names :
[regulatory protein E2; Regulatory protein E2; regulatory protein E2]
products gene name :
[VE2]
other gene names :
[E2; E2]
host :
E Coli
sequence positions :
[Full Length, 1-365aa]
sequence :
LQLTLETIYNSQYSNEKWTLQDVSLEVYLTAPTGCIKKHGYTVEVQFDGDICNTMHYTNWTHIYICEEASVTVV EGQVDYYGLYYVHEGIRTYFVQFKDDAEKYSKNKVWEVHAGGQVILCPTSVFSSNEVSSPEIIRQHLANHPAA THTKAVALGTEETQTTIQRPRSEPDTGNPCHTTKLLHRDSVDSAPILTAFNSSHKGRINCNSNTTPIVHLKGD NTLKCLRYRFKKHCTLYTAVSSTWHWTGHNVKHKSAIVTLTYDSEWQRDQFLSQVKIPKTITVSTGFMSI
METLCQRLNVCQDKILTHYENDSTDLRDHIDYWKHMRLE
CAIYYKAREMGFKHINHQVVPTLAVSKNKALQAIE
purity :
Greater than 90% as determined by SDS-PAGE.
form :
20mM Tris-HCl based buffer, pH8.0
storage stability :
Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info2 :
Target Name: VE2. Target Species: HPV16. Calculated MW: 69.2 kD . Tag Info: GST-tag
products description :
Plays an accessory role in initiation of DNA replication. A dimer of E2 interacts with a dimer of E1 in order to improve specificity of E1 DNA binding activity. Once the complex recognizes and binds DNA at specific sites, the E2 dimer is roved from DNA. E2 also regulates viral transcription through binding to the E2RE response elent (5'-ACCNNNNNNGGT-3') present in multiple copies in the regulatory regions of the viral genome. Activates or represses transcription depending on E2RE's position with regards to proximal promoter elents including the TATA-box. Repression occurs by sterically hindering the assbly of the transcription initiation complex.
ncbi gi num :
9627106
ncbi acc num :
NP_041328.1
ncbi gb acc num :
NC_001526.4
uniprot acc num :
P03120
ncbi mol weight :
69.2kD
uniprot summary :
Plays a role in the initiation of viral DNA replication. A dimer of E2 interacts with a dimer of E1 in order to improve specificity of E1 DNA binding activity. Once the complex recognizes and binds DNA at specific sites, the E2 dimer is removed from DNA. E2 also regulates viral transcription through binding to the E2RE response element (5'-ACCNNNNNNGGT-3') present in multiple copies in the regulatory regions of the viral genome. Activates or represses transcription depending on E2RE's position with regards to proximal promoter elements including the TATA-box. Repression occurs by sterically hindering the assembly of the transcription initiation complex.
size1 :
0.01 mg
price1 :
180 USD
size2 :
0.05 mg
price2 :
225
size3 :
0.1 mg
price3 :
320
size4 :
0.2 mg
price4 :
500
size5 :
0.5 mg
price5 :
800
size6 :
1 mg
price6 :
1235
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!