protein

Recombinant mouse Complement C3

MBS9421058

0.01 mg

230 USD

Recombinant Protein

Recombinant mouse Complement C3

[Complement C3]

[HSE-MSF]

[complement C3 preproprotein; Complement C3; complement C3; complement component 3; HSE-MSF]

[CO3]

[C3; C3; ASP; Plp; HSE-MSF; AI255234; C3bc; ASP]

E. coli

SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCK
KFDLRVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDA
TMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKA
FSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGS
VKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAE
ENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIEL
LDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNA
LKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWP
EAEECQDQKYQKQCEELGAFTESMVVYGCPN

Greater than 90% as determined by SDS-PAGE.

Tris-based buffer 50% glycerol

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature, and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C, -80°C. The shelf life of lyophilized form is 12 months at -20°C, -80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Immunogen Description: Expression Region: 1321-1663aa; Sequence Info: Partial

Tag Info: N-terminal 6xHis-SUMO-tagged

C3 plays a central role in the activation of the complent syst. Its processing by C3 convertase is the central reaction in both classical and alternative complent pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates.Derived from proteolytic degradation of complent C3, C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a choattractant for neutrophils. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes. The short isoform has B-cell stimulatory activity.C3-beta-c: Acts as a choattractant for neutrophils in chronic inflammation.Acylation stimulating protein: adipogenic hormone that stimulates triglyceride (TG) synthesis and glucose transport in adipocytes, regulating fat storage and playing a role in postprandial TG clearance. Appears to stimulate TG synthesis via activation of the PLC, MAPK and AKT signaling pathways. Ligand for C5AR2. Promotes the phosphorylation, ARRB2-mediated internalization and recycling of C5AR2.

126518317

NP_033908.2

NM_009778.3

P01027

55.3 kDa

Activation Of C3 And C5 Pathway (1110737); Adaptive Immune System Pathway (1110669); Alternative Complement Activation Pathway (1110736); Chagas Disease (American Trypanosomiasis) Pathway (147810); Chagas Disease (American Trypanosomiasis) Pathway (147795); Class A/1 (Rhodopsin-like Receptors) Pathway (1110499); Complement Activation, Classical Pathway (198379); Complement And Coagulation Cascades Pathway (198335); Complement And Coagulation Cascades Pathway (83270); Complement And Coagulation Cascades Pathway (484)

This gene encodes complement protein C3 which plays a central role in the classical, alternative and lectin activation pathways of the complement system. The encoded preproprotein undergoes a multi-step processing to generate various functional peptides. Mice deficient in the encoded protein fail to clear bacteria from the blood stream upon infection, display diminished airway hyperresponsiveness and lung eosinophilia upon allergen-induced pulmonary allergy, and develop severe lung injury after deposition of IgG immune complexes. Deficiency of the homolog of the encoded protein in humans was found to be associated with increased susceptibility to infections, age-related macular degeneration, and atypical hemolytic uremic syndrome. [provided by RefSeq, Mar 2015]

C3: C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. Defects in C3 are the cause of complement component 3 deficiency (C3D). A rare defect of the complement classical pathway. Patients develop recurrent, severe, pyogenic infections because of ineffective opsonization of pathogens. Some patients may also develop autoimmune disorders, such as arthralgia and vasculitic rashes, lupus-like syndrome and membranoproliferative glomerulonephritis. Genetic variation in C3 is associated with susceptibility to age-related macular degeneration type 9 (ARMD9). ARMD is a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin- containing structure known as Bruch membrane. Defects in C3 are a cause of susceptibility to hemolytic uremic syndrome atypical type 5 (AHUS5). An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype. Increased levels of C3 and its cleavage product ASP, are associated with obesity, diabetes and coronary heart disease. Short-term endurance training reduces baseline ASP levels and subsequently fat storage. Protein type: Inhibitor; Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 17 D 17 29.72 cM. Cellular Component: extracellular space. Molecular Function: C5L2 anaphylatoxin chemotactic receptor binding; cofactor binding; lipid binding; protein binding. Biological Process: blood coagulation; complement activation; positive regulation of activation of membrane attack complex; positive regulation of angiogenesis; positive regulation of developmental growth; positive regulation of G-protein coupled receptor protein signaling pathway; positive regulation of phagocytosis; positive regulation of protein amino acid phosphorylation; positive regulation of type IIa hypersensitivity

0.01 mg

230 USD

0.05 mg

290

0.1 mg

455

0.2 mg

710

0.5 mg

1145

1 mg

1795