product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant mouse Major urinary proteins 11 and 8
catalog :
MBS9421035
quantity :
0.01 mg
price :
230 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9421035
products type :
Recombinant Protein
products full name :
Recombinant mouse Major urinary proteins 11 and 8
products short name :
[Major urinary proteins 11 and 8]
products name syn :
[MUP11 and MUP8]
other names :
[major urinary protein 11; Major urinary protein 11; major urinary protein 11; major urinary protein 11]
products gene name :
[MUP8]
other gene names :
[Mup11; Mup11; Gm12549]
host :
E Coli
reactivity :
Mouse
sequence positions :
[32-181aa]
sequence :
REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEN
SLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNT
FTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSS
DIKERFAQLCEEHGILRENIIDLSNANRCLQARE
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer50% glycerol
storage stability :
The shelf life is related to many factors , storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info1 :
Calculated MW: 21.6 kDa. Tag Info: N-terminal 6xHis-tagged
products description :
Recombinant protein. Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.
ncbi gi num :
257153315
ncbi acc num :
NP_001157998.1
ncbi gb acc num :
NM_001164526.1
uniprot acc num :
P04938
ncbi mol weight :
21.6kD
uniprot summary :
Mup11: Major urinary proteins (Mups) bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance (Probable). Binds the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT) in vitro. Chromosomal Location of Human Ortholog: 4 4 B3
size1 :
0.01 mg
price1 :
230 USD
size2 :
0.05 mg
price2 :
290
size3 :
0.1 mg
price3 :
455
size4 :
0.2 mg
price4 :
710
size5 :
0.5 mg
price5 :
1145
size6 :
1 mg
price6 :
1795
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!