product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Human Tumor necrosis factor-inducible gene 6 protein
catalog :
MBS9420758
quantity :
0.01 mg
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9420758
products type :
Recombinant Protein
products full name :
Recombinant Human Tumor necrosis factor-inducible gene 6 protein
products short name :
[Tumor necrosis factor-inducible gene 6]
products name syn :
[Hyaluronate-binding protein; TNF-stimulated gene 6 protein; TSG-6; Tumor necrosis factor alpha-induced protein 6; TNF alpha-induced protein 6]
other names :
[tumor necrosis factor-inducible gene 6 protein; Tumor necrosis factor-inducible gene 6 protein; tumor necrosis factor-inducible gene 6 protein; TNF alpha induced protein 6; Hyaluronate-binding protein; TNF-stimulated gene 6 protein; TSG-6; Tumor necrosis factor alpha-induced protein 6; TNF alpha-induced protein 6]
products gene name :
[TSG6]
other gene names :
[TNFAIP6; TNFAIP6; TSG6; TSG-6; TSG6; TSG-6; TNF alpha-induced protein 6]
host :
E Coli
reactivity :
Human
sequence positions :
[Full Length, 18-277aa]
sequence :
WGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKA
VCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYP
IVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKE
CGGVFTDPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRI
HLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGD
ELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVS
KSSQGKNTSTTSTGNKNFLAGRFSHL
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info1 :
Immunogen: Expression Region:18-277aa; Sequence Info: Full Length
other info2 :
Tag: N-terminal 6xHis-tagged
products description :
Possibly involved in cell-cell and cell-matrix interactions during inflammation and tumorigenesis.
ncbi gi num :
26051243
ncbi acc num :
NP_009046.2
ncbi gb acc num :
NM_007115.3
uniprot acc num :
P98066
ncbi mol weight :
33.1 kDa
ncbi summary :
The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.[provided by RefSeq, Dec 2010]
uniprot summary :
TNFAIP6: Possibly involved in cell-cell and cell-matrix interactions during inflammation and tumorigenesis. Chromosomal Location of Human Ortholog: 2q23.3. Cellular Component: extracellular region. Molecular Function: protein binding. Biological Process: cell-cell signaling; inflammatory response; negative regulation of inflammatory response; neutrophil degranulation; signal transduction
size1 :
0.01 mg
price1 :
180 USD
size2 :
0.05 mg
price2 :
225
size3 :
0.1 mg
price3 :
320
size4 :
0.2 mg
price4 :
500
size5 :
0.5 mg
price5 :
800
size6 :
1 mg
price6 :
1235
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!