Recombinant Human Serine/arginine-rich splicing factor 1 | MyBioSource MBS9420668 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Serine/arginine-rich splicing factor 1

catalog :

MBS9420668

quantity :

0.01 mg

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS9420668

products type :

Recombinant Protein

products full name :

Recombinant Human Serine/arginine-rich splicing factor 1

products short name :

[Serine/arginine-rich splicing factor 1]

products name syn :

[Alternative-splicing factor 1; ASF-1Splicing factor; arginine/serine-rich 1pre-mRNA-splicing factor SF2; P33 subunit]

other names :

[serine/arginine-rich splicing factor 1 isoform 2; Serine/arginine-rich splicing factor 1; serine/arginine-rich splicing factor 1; serine and arginine rich splicing factor 1; Alternative-splicing factor 1; ASF-1; Splicing factor, arginine/serine-rich 1; pre-mRNA-splicing factor SF2, P33 subunit]

products gene name :

[SRSF1]

other gene names :

[SRSF1; SRSF1; ASF; SF2; SFRS1; SF2p33; SRp30a; ASF; SF2; SF2P33; SFRS1; ASF-1]

host :

E Coli

reactivity :

Human

sequence positions :

[Full Length, 2-248aa]

sequence :

SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYG
AIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDY
DGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRR
SENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGT
GVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDG
PRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSP
RYSPRHSRSRSRT

purity :

Greater than 90% as determined by SDS-PAGE.

form :

20mM Tris-HCl based buffer, pH8.0

storage stability :

Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

other info2 :

Tag Info: His-SUMO-tag

products description :

Plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. Interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice site-containing pre-mRNA. Binds to purine-rich RNA sequences, either the octamer, 5'-RGAAGAAC-3' (r=A or G) or the decamers, AGGACAGAGC/AGGACGAAGC. Binds preferentially to the 5'-CGAGGCG-3' motif in vitro. Three copies of the octamer constitute a powerful splicing enhancer in vitro, the ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. May function as export adapter involved in mRNA nuclear export through the TAP/NXF1 pathway.

ncbi gi num :

118582269

ncbi acc num :

NP_001071634.1

ncbi gb acc num :

NM_001078166.1

uniprot acc num :

Q07955

ncbi mol weight :

43.6kD

ncbi pathways :

Cleavage Of Growing Transcript In The Termination Region Pathway (106560); Gene Expression Pathway (105937); Herpes Simplex Infection Pathway (377873); Herpes Simplex Infection Pathway (377865); Processing Of Capped Intron-Containing Pre-mRNA Pathway (160950); RNA Polymerase II Transcription Pathway (106557); RNA Polymerase II Transcription Termination Pathway (106559); Spliceosome Pathway (125136); Spliceosome Pathway (124832); Transport Of Mature Transcript To Cytoplasm Pathway (105959)

ncbi summary :

This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13. [provided by RefSeq, Jun 2014]

uniprot summary :

SF2: a serine-arginine-rich splicing regulatory protein. Plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. Interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5' and 3' splice site binding components, U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice-site-containing pre-mRNA. Extensively phosphorylated on serine residues in the serine-arginine rich region. Three splice variant isoforms have been described. ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. Protein type: RNA splicing; RNA-binding; Spliceosome. Chromosomal Location of Human Ortholog: 17q22. Cellular Component: nuclear speck; nucleoplasm; nucleus. Molecular Function: mRNA binding; protein binding; RNA binding. Biological Process: alternative nuclear mRNA splicing, via spliceosome; mRNA 3'-end processing; mRNA export from nucleus; mRNA processing; mRNA splice site selection; nuclear mRNA 5'-splice site recognition; nuclear mRNA splicing, via spliceosome; RNA export from nucleus; termination of RNA polymerase II transcription

size1 :

0.01 mg

price1 :

180 USD

size2 :

0.05 mg

price2 :

225

size3 :

0.1 mg

price3 :

320

size4 :

0.2 mg

price4 :

500

size5 :

0.5 mg

price5 :

800

size6 :

1 mg

price6 :

1235

more info or order :

MyBioSource product webpage