product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant mouse Serum amyloid A-2 protein
catalog :
MBS9420646
quantity :
0.01 mg
price :
230 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9420646
products type :
Recombinant Protein
products full name :
Recombinant mouse Serum amyloid A-2 protein
products short name :
[Serum amyloid A-2]
products name syn :
[Amyloid fibril protein AA]
other names :
[serum amyloid A-2 protein; Serum amyloid A-2 protein; serum amyloid A-2 protein; serum amyloid A 2; Amyloid protein AAlternative name(s):Amyloid fibril protein AA]
products gene name :
[SAA2]
other gene names :
[Saa2; Saa2; Saa1; Saa-2; AW111173]
host :
E Coli
reactivity :
Mouse
sequence positions :
[Full Length, 20-122aa]
sequence :
GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARG
NYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMAD
QEANRHGRSGKDPNYYRPPGLPAKY
purity :
Greater than 90% as determined by SDS-PAGE.
form :
20mM Tris-HCl based buffer, pH8.0
storage stability :
Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info1 :
Calculated MW: 15.7 kD
other info2 :
Tag Info: His-tag
products description :
Recombinant Protein. Major acute phase reactant. Apolipoprotein of the HDL complex.
ncbi gi num :
6755394
ncbi acc num :
NP_035444.1
ncbi gb acc num :
NM_011314.2
uniprot acc num :
P05367
uniprot summary :
SAA2: Major acute phase reactant. Apolipoprotein of the HDL complex. Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA2 protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function. Belongs to the SAA family. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 7 B3 7 30.56 cM. Cellular Component: cytoplasmic microtubule; extracellular space. Molecular Function: chemoattractant activity; G-protein-coupled receptor binding; protein binding
size1 :
0.01 mg
price1 :
230 USD
size2 :
0.05 mg
price2 :
290
size3 :
0.1 mg
price3 :
455
size4 :
0.2 mg
price4 :
710
size5 :
0.5 mg
price5 :
1145
size6 :
1 mg
price6 :
1795
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!