NYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMAD
QEANRHGRSGKDPNYYRPPGLPAKY

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Human Serine/arginine-rich splicing factor 1 | MBS9420668
- Recombinant sheep Protransforming growth factor alpha | MBS9420735
- Recombinant Human Tumor necrosis factor-inducible gene 6 protein | MBS9420758
- Recombinant mouse Cellular tumor antigen p53 | MBS9420764
- Recombinant mouse Major urinary protein 2 | MBS9420873
