catalog number :
MBS9420623
products type :
Recombinant Protein
products full name :
Recombinant Human Nuclear receptor ROR-gamma
products short name :
[Nuclear receptor ROR-gamma]
products name syn :
[Nuclear receptor RZR-gammaNuclear receptor subfamily 1 group F member 3RAR-related orphan receptor CRetinoid-related orphan receptor-gamma]
other names :
[nuclear receptor ROR-gamma isoform b; Nuclear receptor ROR-gamma; nuclear receptor ROR-gamma; RAR related orphan receptor C; Nuclear receptor RZR-gamma; Nuclear receptor subfamily 1 group F member 3; RAR-related orphan receptor C; Retinoid-related orphan receptor-gamma]
products gene name :
[RORG]
other gene names :
[RORC; RORC; TOR; RORG; RZRG; IMD42; NR1F3; RZR-GAMMA; NR1F3; RORG; RZRG]
sequence positions :
[Full Length, 1-518aa]
sequence :
PIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQG
ADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRE
SFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQL
RLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLL.
KAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIAL
YTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQI
FQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSS
GIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNC
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer 50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info1 :
Calculated MW: 74.2 kDa. Tag Info: N-terminal 6xHis-SUMO-tagged. Immunogen Description: Expression Region: 1-518 aa Sequence Info: Full length
products description :
Nuclear receptor that binds DNA as a monomer to ROR response elents (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of cellular differentiation, immunity, peripheral circadian rhythm as well as lipid, steroid, xenobiotics and glucose metabolism. Considered to have intrinsic transcriptional activity, have some natural ligands like oxysterols that act as agonists (25-hydroxycholesterol) or inverse agonists (7-oxygenated sterols), enhancing or repressing the transcriptional activity, respectively. Recruits distinct combinations of cofactors to target gene regulatory regions to modulate their transcriptional expression, depending on the tissue, time and promoter contexts. Regulates the circadian expression of clock genes such as CRY1, ARNTL/BMAL1 and NR1D1 in peripheral tissues and in a tissue-selective manner. Competes with NR1D1 for binding to their shared DNA response elent on some clock genes such as ARNTL/BMAL1, CRY1 and NR1D1 itself, resulting in NR1D1-mediated repression or RORC-mediated activation of the expression, leading to the circadian pattern of clock genes expression. Therefore influences the period length and stability of the clock. Involved in the regulation of the rhythmic expression of genes involved in glucose and lipid metabolism, including PLIN2 and AVPR1A. Negative regulator of adipocyte differentiation through the regulation of early phase genes expression, such as MMP3. Controls adipogenesis as well as adipocyte size and modulates insulin sensitivity in obesity. In liver, has specific and redundant functions with RORA as positive or negative modulator of expression of genes encoding phase I and Phase II proteins involved in the metabolism of lipids, steroids and xenobiotics, such as SULT1E1. Also plays also a role in the regulation of hepatocyte glucose metabolism through the regulation of G6PC and PCK1. Regulates the rhythmic expression of PROX1 and promotes its nuclear localization.
ncbi acc num :
NP_001001523.1
ncbi gb acc num :
NP_001001523.1
ncbi pathways :
Circadian Rhythm Pathway (83084); Circadian Rhythm Pathway (495); Gene Expression Pathway (105937); Generic Transcription Pathway (105938); Nuclear Receptor Transcription Pathway (105979); Nuclear Receptors Pathway (198848)
ncbi summary :
The protein encoded by this gene is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that this gene may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
uniprot summary :
RORC: Possible nuclear receptor for hydroxycholesterols, the binding of which strongly promotes coactivators recruitment. Essential for thymopoiesis and the development of several secondary lymphoid tissues, including lymph nodes. Involved in lineage specification of uncommitted CD4(+) T-helper cells into Th17 cells. Regulate the expression of several components of the circadian clock. Belongs to the nuclear hormone receptor family. NR1 subfamily. 2 isoforms of the human protein are produced by alternative splicing. Protein type: DNA-binding; Nuclear receptor; Transcription factor. Chromosomal Location of Human Ortholog: 1q21.3. Cellular Component: nuclear body; nucleoplasm; nucleus. Molecular Function: oxysterol binding; protein binding; transcription factor activity. Biological Process: circadian regulation of gene expression; positive regulation of circadian rhythm; positive regulation of transcription, DNA-dependent; regulation of fat cell differentiation; regulation of steroid metabolic process; transcription initiation from RNA polymerase II promoter; xenobiotic metabolic process. Disease: Immunodeficiency 42