catalog number :
MBS9420618
products type :
Recombinant Protein
products full name :
Recombinant Human Receptor-interacting serine/threonine-protein kinase 2
products short name :
[Receptor-interacting serine/threonine-protein kinase 2]
products name syn :
[CARD-containing interleukin-1 beta-converting enzyme-associated kinase; CARD-containing IL-1 beta ICE-kinaseRIP-like-interacting CLARP kinaseReceptor-interacting protein 2; RIP-2Tyrosine-protein kinase RIPK2 (EC:2.7.10.2)]
other names :
[receptor-interacting serine/threonine-protein kinase 2; Receptor-interacting serine/threonine-protein kinase 2; receptor-interacting serine/threonine-protein kinase 2; receptor interacting serine/threonine kinase 2; CARD-containing interleukin-1 beta-converting enzyme-associated kinase; CARD-containing IL-1 beta ICE-kinase; RIP-like-interacting CLARP kinase; Receptor-interacting protein 2; RIP-2; Tyrosine-protein kinase RIPK2 (EC:2.7.10.2)]
products gene name :
[RIPK2]
other gene names :
[RIPK2; RIPK2; CCK; RICK; RIP2; CARD3; GIG30; CARDIAK; CARDIAK; RICK; RIP2; CARD-containing IL-1 beta ICE-kinase; RIP-2]
sequence positions :
[Full Length, 1-540aa]
sequence :
MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHAD
WRVQVAVKHLHIHTPLLDSERKDVLREAEILHKARFSYI
LPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVA
WPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDN
EFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPP
ENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTN
PLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGW
AQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLKKT
KLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQL
HENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKLHHCPG
NHSWDSTISGSQRAAFCDHKTTPCSSAIINPLSTAGNSE
RLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDL
IMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQ
KLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
purity :
Greater than 90% as determined by SDS-PAGE.
form :
20mM Tris-HCl based buffer, pH8.0
storage stability :
Store at -20°C, for extended storage, conserve at -20° C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info2 :
Tag Info: His-tag
products description :
Serine/threonine/tyrosine kinase that plays an essential role in modulation of innate and adaptive immune responses. Upon stimulation by bacterial peptidoglycans, NOD1 and NOD2 are activated, oligomerize and recruit RIPK2 through CARD-CARD domains. Contributes to the tyrosine phosphorylation of the guanine exchange factor ARHGEF2 through Src tyrosine kinase leading to NF-kappaB activation by NOD2. Once recruited, RIPK2 autophosphorylates and undergoes 'Lys-63'-linked polyubiquitination by E3 ubiquitin ligases XIAP, BIRC2 and BIRC3. The polyubiquitinated protein mediates the recruitment of MAP3K7/TAK1 to IKBKG/NO and induces 'Lys-63'-linked polyubiquitination of IKBKG/NO and subsequent activation of IKBKB/IKKB. In turn, NF-kappa-B is released from NF-kappa-B inhibitors and translocates into the nucleus where it activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Plays also a role during engagent of the T-cell receptor (TCR) in promoting BCL10 phosphorylation and subsequent NF-kappa-B activation.
ncbi acc num :
NP_003812.1
ncbi gb acc num :
NM_003821.5
ncbi pathways :
Activated TLR4 Signalling Pathway (106400); Adaptive Immune System Pathway (366160); Canonical NF-kappaB Pathway (138030); Cytokine Signaling In Immune System Pathway (366171); Downstream TCR Signaling Pathway (106418); FAS Pathway And Stress Induction Of HSP Regulation (198894); IL12-mediated Signaling Events Pathway (137922); Immune System Pathway (106386); Innate Immune System Pathway (106387); Interleukin-1 Signaling Pathway (160141)
ncbi summary :
This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. [provided by RefSeq, Jul 2008]
uniprot summary :
RIPK2: a tyrosine kinase-like kinase of the RIPK family. Activates pro-caspase-1 and pro-caspase-8. Potentiates casp-8-mediated apoptosis. May activate NF-kappaB. Protein type: EC 2.7.10.2; EC 2.7.11.1; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); Protein kinase, TKL; RIPK family; TKL group. Chromosomal Location of Human Ortholog: 8q21.3. Cellular Component: cytoplasm; cytoskeleton; cytosol; protein complex; vesicle. Molecular Function: CARD domain binding; identical protein binding; LIM domain binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor binding; signal transducer activity. Biological Process: activation of MAPK activity; activation of NF-kappaB transcription factor; adaptive immune response; I-kappaB kinase/NF-kappaB cascade; inflammatory response; innate immune response; JNK cascade; MAPKKK cascade; negative regulation of apoptosis; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of interleukin-1 beta secretion; positive regulation of peptidyl-serine phosphorylation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of protein binding; positive regulation of protein ubiquitination; protein deubiquitination; signal transduction; T cell receptor signaling pathway; toll-like receptor 2 signaling pathway