product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant mouse Resistin
catalog :
MBS9420613
quantity :
0.01 mg
price :
230 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9420613
products type :
Recombinant Protein
products full name :
Recombinant mouse Resistin
products short name :
[Resistin]
products name syn :
[Adipose tissue-specific secretory factor; ADSFAdipose-specific cysteine-rich secreted protein A12-alpha; Cysteine-rich secreted protein FIZZ3]
other names :
[resistin; Resistin; Adipose tissue-specific secretory factor; ADSF; Adipose-specific cysteine-rich secreted protein A12-alpha; Cysteine-rich secreted protein FIZZ3]
products gene name :
[RETN]
other gene names :
[Retn; Fizz3; ADSF]
host :
E Coli
reactivity :
Mouse
sequence positions :
[Full Length, 21-114aa]
sequence :
SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVS
SRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCA
RIDWTAARCCKLQVAS
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer 50% glycerol
storage stability :
The shelf life is related to many factors, storage state buffer ingredients, storage temperature and the stability of the protein itself. Generally the shelf life of liquid form is 6 months at -20°C, -80°C. The shelf life is lyophilized form is 12 months at -20°C to -80°C. Notes: Repeated freezing and thawing is not recommended . Store working aliquots at 4°C for up to one week.
other info1 :
Immunogen Description: Expression Region: 21-114 aa- Sequence Info: Full Length. Calculated MW: 14.2 kDa
other info2 :
Tag Info: N-terminal 6xHis tagged
products description :
Recombinant Protein. Hormone that ses to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.
ncbi gi num :
326368221
ncbi acc num :
NP_001191888.1
ncbi gb acc num :
NM_001204959.1
uniprot acc num :
Q99P87
ncbi pathways :
Adipogenesis Pathway (198299)
uniprot summary :
resistin: Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes. Belongs to the resistin/FIZZ family. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 8 A1.1 8 1.92 cM. Cellular Component: extracellular region; extracellular space; nucleus. Molecular Function: hormone activity. Biological Process: fat cell differentiation; positive regulation of smooth muscle cell migration; positive regulation of smooth muscle cell proliferation; positive regulation of synaptic transmission; response to insulin stimulus
size1 :
0.01 mg
price1 :
230 USD
size2 :
0.05 mg
price2 :
290
size3 :
0.1 mg
price3 :
455
size4 :
0.2 mg
price4 :
710
size5 :
0.5 mg
price5 :
1145
size6 :
1 mg
price6 :
1795
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!