catalog number :
MBS9420599
products type :
Recombinant Protein
products full name :
Recombinant Human RAF proto-oncogene serine/threonine-protein kinase
products short name :
[RAF proto-oncogene serine/threonine-protein kinase]
products name syn :
[Proto-oncogene c-RAF; cRafRaf-1]
other names :
[RAF proto-oncogene serine/threonine-protein kinase; RAF proto-oncogene serine/threonine-protein kinase; RAF proto-oncogene serine/threonine-protein kinase; Raf-1 proto-oncogene, serine/threonine kinase; Proto-oncogene c-RAF; cRaf; Raf-1]
products gene name :
[RAF1]
other gene names :
[RAF1; RAF1; NS5; CRAF; Raf-1; c-Raf; CMD1NN; RAF; cRaf]
purity :
Greater than 90% as determined by SDS-PAGE.
form :
20mM Tris-HCl based buffer, pH8.0
storage stability :
Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info1 :
Calculated MW: 89 kD. Target Species: Human. Tag Info: His-SUMO-tag. Target Length: Full length,1-648aa
other info2 :
PECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMC
VDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRM
IEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKW
HGDVAVKILKVVDPTPEQFQAFRNEVAVRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHA
KNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNR
DQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQ
RRASDDGKLTDPSKTSNTIRVFLPNKQRTVVNVRNGMSL
HDCLMKALKVRGLQ
Target Sequence:
ncbi acc num :
NP_002871.1
ncbi gb acc num :
NM_002880.3
ncbi pathways :
AGE/RAGE Pathway (698754); ARMS-mediated Activation Pathway (106466); Activation Of NMDA Receptor Upon Glutamate Binding And Postsynaptic Events Pathway (161033); Acute Myeloid Leukemia Pathway (83117); Acute Myeloid Leukemia Pathway (529); Adaptive Immune System Pathway (366160); Alcoholism Pathway (585563); Alcoholism Pathway (587116); Axon Guidance Pathway (105688); B Cell Receptor Signaling Pathway (198909)
ncbi summary :
This gene is the cellular homolog of viral raf gene (v-raf). The encoded protein is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. Once activated, the cellular RAF1 protein can phosphorylate to activate the dual specificity protein kinases MEK1 and MEK2, which in turn phosphorylate to activate the serine/threonine specific protein kinases, ERK1 and ERK2. Activated ERKs are pleiotropic effectors of cell physiology and play an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Mutations in this gene are associated with Noonan syndrome 5 and LEOPARD syndrome 2. [provided by RefSeq, Jul 2008]
uniprot summary :
Serine/threonine-protein kinase that acts as a regulatory link between the membrane-associated Ras GTPases and the MAPK/ERK cascade, and this critical regulatory link functions as a switch determining cell fate decisions including proliferation, differentiation, apoptosis, survival and oncogenic transformation. RAF1 activation initiates a mitogen-activated protein kinase (MAPK) cascade that comprises a sequential phosphorylation of the dual-specific MAPK kinases (MAP2K1/MEK1 and MAP2K2/MEK2) and the extracellular signal-regulated kinases (MAPK3/ERK1 and MAPK1/ERK2). The phosphorylated form of RAF1 (on residues Ser-338 and Ser-339, by PAK1) phosphorylates BAD/Bcl2-antagonist of cell death at 'Ser-75'. Phosphorylates adenylyl cyclases: ADCY2, ADCY5 and ADCY6, resulting in their activation. Phosphorylates PPP1R12A resulting in inhibition of the phosphatase activity. Phosphorylates TNNT2/cardiac muscle troponin T. Can promote NF-kB activation and inhibit signal transducers involved in motility (ROCK2), apoptosis (MAP3K5/ASK1 and STK3/MST2), proliferation and angiogenesis (RB1). Can protect cells from apoptosis also by translocating to the mitochondria where it binds BCL2 and displaces BAD/Bcl2-antagonist of cell death. Regulates Rho signaling and migration, and is required for normal wound healing. Plays a role in the oncogenic transformation of epithelial cells via repression of the TJ protein, occludin (OCLN) by inducing the up-regulation of a transcriptional repressor SNAI2/SLUG, which induces down-regulation of OCLN. Restricts caspase activation in response to selected stimuli, notably Fas stimulation, pathogen-mediated macrophage apoptosis, and erythroid differentiation.