Recombinant Human Serum paraoxonase/arylesterase 1 | MyBioSource MBS9420554 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Serum paraoxonase/arylesterase 1

catalog :

MBS9420554

quantity :

0.01 mg

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS9420554

products type :

Recombinant Protein

products full name :

Recombinant Human Serum paraoxonase/arylesterase 1

products short name :

[Serum paraoxonase/arylesterase 1]

products name syn :

[Aromatic esterase 1; A-esterase 1K-45Serum aryldialkylphosphatase 1]

other names :

[serum paraoxonase/arylesterase 1; Serum paraoxonase/arylesterase 1; serum paraoxonase/arylesterase 1; paraoxonase 1; Aromatic esterase 1; A-esterase 1; K-45; Serum aryldialkylphosphatase 1]

products gene name :

[PON1]

other gene names :

[PON1; PON1; ESA; PON; MVCD5; PON; A-esterase 1]

host :

E Coli

reactivity :

Human

sequence positions :

[Full Length, 2-355aa]

purity :

Greater than 90% as determined by SDS-PAGE.

form :

20mM Tris-HCl based buffer, pH8.0

storage stability :

Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

other info1 :

. Tag Info: GST-tag. Target Name: PON1. Calculated MW: 67 kD

other info2 :

PTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYGTNDHYFL. DPYLQSWEMYLGLAWSYVVYYSPSEVRVVAEGFDFANGNISPDGKYVYIAELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPET. GDLWVGCHPNGMKIFFYDSENPPASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKALYCEL
AKLIALTLLGMGLALFRNHQSSYQTRLNALREVQPVELP
NCNLVKGIETGSEDLEILPNGLAFISSGLKYPGIKSFNP
NSPGKILLMDLNEED.
. Target Sequence:

products description :

Recombinant Protein. Hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. Capable of hydrolyzing a broad spectrum of organophosphate substrates and lactones, and a number of aromatic carboxylic acid esters. Mediates an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation.

ncbi gi num :

19923106

ncbi acc num :

NP_000437.3

ncbi gb acc num :

NM_000446.5

uniprot acc num :

P27169

ncbi pathways :

Phase I, Non P450 Pathway (198854)

ncbi summary :

The enzyme encoded by this gene is an arylesterase that mainly hydrolyzes paroxon to produce p-nitrophenol. Paroxon is an organophosphorus anticholinesterase compound that is produced in vivo by oxidation of the insecticide parathion. Polymorphisms in this gene are a risk factor in coronary artery disease. The gene is found in a cluster of three related paraoxonase genes at 7q21.3. [provided by RefSeq, Oct 2008]

uniprot summary :

PON1: Hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. Capable of hydrolyzing a broad spectrum of organophosphate substrates and lactones, and a number of aromatic carboxylic acid esters. Mediates an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation. Genetic variation in PON1 is associated with susceptibility to microvascular complications of diabetes type 5 (MVCD5). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new- onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Homozygosity for the Leu-54 allele is strongly associated with the development of retinal disease in diabetic patients. Belongs to the paraoxonase family. Protein type: EC 3.1.1.2; EC 3.1.1.81; EC 3.1.8.1; Hydrolase; Lipid-binding; Motility/polarity/chemotaxis; Phosphatase (non-protein); Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 7q21.3. Cellular Component: extracellular region; extracellular space. Molecular Function: aryldialkylphosphatase activity; arylesterase activity; calcium ion binding; phospholipid binding; protein homodimerization activity. Biological Process: aromatic compound catabolic process; carboxylic acid catabolic process; lipoxygenase pathway; organophosphate catabolic process; phosphatidylcholine metabolic process; positive regulation of binding; positive regulation of transporter activity; response to toxin. Disease: Microvascular Complications Of Diabetes, Susceptibility To, 5

size1 :

0.01 mg

price1 :

180 USD

size2 :

0.05 mg

price2 :

225

size3 :

0.1 mg

price3 :

320

size4 :

0.2 mg

price4 :

500

size5 :

0.5 mg

price5 :

800

size6 :

1 mg

price6 :

1235

more info or order :

MyBioSource product webpage