catalog number :
MBS9420466
products type :
Recombinant Protein
products full name :
Recombinant Human Thrombopoietin receptor
products short name :
[Thrombopoietin receptor]
products name syn :
[Myeloproliferative leukemia protein; Proto-oncogene c-Mpl; CD110]
other names :
[thrombopoietin receptor; Thrombopoietin receptor; thrombopoietin receptor; MPL proto-oncogene, thrombopoietin receptor; Myeloproliferative leukemia protein; Proto-oncogene c-Mpl; CD_antigen: CD110]
products gene name :
[TPOR]
other gene names :
[MPL; MPL; MPLV; TPOR; C-MPL; CD110; THCYT2; TPOR; TPO-R]
sequence positions :
[Extracellular Domain, 26-491aa]
sequence :
QDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPSGTYQ
LLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRL
FFPLHLWVKNVFLNQTRTQRVLFVDSVGLPAPPSIIKAM
GGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNSTG
PTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQD
GPKQTSPSREASALTAEGGSCLISGLQPGNSYWLQLRSE
PDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKN
VTCQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEE
EKTNPGLQTPQFSRCHFKSRNDSIIHILVEVTTAPGTVH
SYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSS
WAAQETCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPR
SRYRLQLRARLNGPTYQGPWSSWSDPTRVETATETAW
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Tris-based buffer50% glycerol
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. Shipping: Ships with Dry Ice.
other info1 :
Calculated MW: 56.5 kDa. Tag Info: N-terminal 6xHis-tagged
products description :
Receptor for thrombopoietin. May represent a regulatory molecule specific for TPO-R-dependent immune responses.
ncbi acc num :
NP_005364.1
ncbi gb acc num :
NM_005373.2
ncbi pathways :
Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Hemostasis Pathway (106028); Jak-STAT Signaling Pathway (83077); Jak-STAT Signaling Pathway (488); Platelet Aggregation (Plug Formation) Pathway (106053); Platelet Activation, Signaling And Aggregation Pathway (106034)
ncbi summary :
In 1990 an oncogene, v-mpl, was identified from the murine myeloproliferative leukemia virus that was capable of immortalizing bone marrow hematopoietic cells from different lineages. In 1992 the human homologue, named, c-mpl, was cloned. Sequence data revealed that c-mpl encoded a protein that was homologous with members of the hematopoietic receptor superfamily. Presence of anti-sense oligodeoxynucleotides of c-mpl inhibited megakaryocyte colony formation. The ligand for c-mpl, thrombopoietin, was cloned in 1994. Thrombopoietin was shown to be the major regulator of megakaryocytopoiesis and platelet formation. The protein encoded by the c-mpl gene, CD110, is a 635 amino acid transmembrane domain, with two extracellular cytokine receptor domains and two intracellular cytokine receptor box motifs . TPO-R deficient mice were severely thrombocytopenic, emphasizing the important role of CD110 and thrombopoietin in megakaryocyte and platelet formation. Upon binding of thrombopoietin CD110 is dimerized and the JAK family of non-receptor tyrosine kinases, as well as the STAT family, the MAPK family, the adaptor protein Shc and the receptors themselves become tyrosine phosphorylated. [provided by RefSeq, Jul 2008]
uniprot summary :
MPL: a hematopoietic receptor for thrombopoietin. Thrombopoietin is the major regulator of megakaryocytopoiesis and platelet formation. Dimerizes upon binding of thrombopoietin, leading to its phosphorylation and activation of JAKs and STATs. May represent a regulatory molecule specific for TPO-R-dependent immune responses. Two splice-variant isoforms have been described. Protein type: Membrane protein, integral; Receptor, cytokine. Chromosomal Location of Human Ortholog: 1p34.2. Cellular Component: cell surface; Golgi apparatus; integral to plasma membrane; plasma membrane. Molecular Function: protein binding; transmembrane receptor activity. Biological Process: cell proliferation; cell surface receptor linked signal transduction. Disease: Amegakaryocytic Thrombocytopenia, Congenital; Myelofibrosis; Thrombocythemia 2