Recombinant mouse E3 ubiquitin-protein ligase Mdm2 | MyBioSource MBS9420451 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant mouse E3 ubiquitin-protein ligase Mdm2

catalog :

MBS9420451

quantity :

0.01 mg

price :

230 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS9420451

products type :

Recombinant Protein

products full name :

Recombinant mouse E3 ubiquitin-protein ligase Mdm2

products short name :

[E3 ubiquitin-protein ligase Mdm2]

products name syn :

[Double minute 2 proteinOncoprotein Mdm2p53-binding protein Mdm2]

other names :

[E3 ubiquitin-protein ligase Mdm2 isoform 2; E3 ubiquitin-protein ligase Mdm2; E3 ubiquitin-protein ligase Mdm2; transformed mouse 3T3 cell double minute 2; Double minute 2 protein; Oncoprotein Mdm2; RING-type E3 ubiquitin transferase Mdm2Curated; p53-binding protein Mdm2]

products gene name :

[MDM2]

other gene names :

[Mdm2; Mdm2; Mdm-2; AA415488; 1700007J15Rik]

host :

E Coli

sequence positions :

[Full Length, 1-489aa]

sequence :

YCSNDLLGDVFGVPSFSVKEHRKIYAMIYRNLVAVSQQDSGTSLSESRRQPEGGSDLKDPLQAPPEEKPSSS DLISRLSTSSRRRSISETEENTDELPGERHRKRRRSLSFDPSLGLCELREMCSGGSSSSSSSSSESTETPSHQ DLDDGVSEHSGDCLDQDSVSDQFSVEFEVESLDSEDYSLSDEGHELSDEDDEVYRVTVYQTGESDTDSFEG DPEISLADYWKCTSCNEMNPPLPSHCKRCWTLRENWLPDDKGKDKVEISEKAKLENSAQAEEGLDVPDGKKL TENDAKEPCAEEDSEEKAEQTPLSQESDDYSQPSTSSSIVYSSQESVKELKEETQDKDESVESSFSLNAIEPC VICQGRPKNGCIVHGKTGHLMSCFTCAKKLKKRNKPCPVCRQPIQMIVLTYFN
MCNTNMSVSTEGAASTSQIPASEQETLVRPKPLLLKLLK
SVGAQNDTYTMKEIIFYIGQYIMTKRLYDEKQQHIV

purity :

Greater than 90% as determined by SDS-PAGE.

form :

20mM Tris-HCl based buffer, pH8.0

storage stability :

Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

other info1 :

Target Name: MDM2. Target Species: Mouse

other info2 :

Tag Info: His-tag

products description :

E3 ubiquitin-protein ligase that mediates ubiquitination of p53/TP53, leading to its degradation by the proteasome. Inhibits p53/TP53- and p73/TP73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Also acts as a ubiquitin ligase E3 toward itself and ARRB1. Permits the nuclear export of p53/TP53. Promotes proteasome-dependent ubiquitin-independent degradation of retinoblastoma RB1 protein. Inhibits DAXX-mediated apoptosis by inducing its ubiquitination and degradation. Component of the TRIM28/KAP1-MDM2-p53/TP53 complex involved in stabilizing p53/TP53. Also component of the TRIM28/KAP1-ERBB4-MDM2 complex which links growth factor and DNA damage response pathways. Mediates ubiquitination and subsequent proteasome degradation of DYRK2 in nucleus. Ubiquitinates IGF1R and SNAI1 and promotes th to proteasomal degradation.

ncbi gi num :

570700841

ncbi acc num :

NP_001275515.1

ncbi gb acc num :

NM_001288586.2

uniprot acc num :

P23804

ncbi mol weight :

58.6kD

ncbi pathways :

AKT Phosphorylates Targets In The Cytosol Pathway (1110363); Adaptive Immune System Pathway (1110669); Androgen Receptor Signaling Pathway (198319); Apoptosis Pathway (198339); Bladder Cancer Pathway (83308); Bladder Cancer Pathway (527); Cell Cycle Pathway (1110064); Cell Cycle Checkpoints Pathway (1110065); Cell Cycle Pathway (83251); Cell Cycle Pathway (198407)

uniprot summary :

MDM2: a ubiquitin ligase for p53, plays a central role in regulation of the stability of p53 via Akt-mediated MDM2 phosphorylation. Phosphorylation of MDM2 increases its interaction with p300, providing a platform to allow the assembly of the protein complex necessary for MDM2-mediated ubiquitination and degradation of p53. Phosphorylation of MDM2 also blocks its binding to p19ARF, increasing the degradation of p53. Facilitates the nuclear export of p53 and targets it for proteasome-mediated proteolysis. Eight alternatively spliced isoforms have been reported. Protein type: EC 6.3.2.-; EC 6.3.2.19; Inhibitor; Ligase; Nucleolus; Oncoprotein; Ubiquitin conjugating system; Ubiquitin ligase. Chromosomal Location of Human Ortholog: 10 D2 10 66.32 cM. Cellular Component: cytoplasm; cytosol; nuclear body; nucleolus; nucleoplasm; nucleus; plasma membrane; protein complex; synapse. Molecular Function: 5S rRNA binding; enzyme binding; identical protein binding; ligase activity; p53 binding; peroxisome proliferator activated receptor binding; protein binding; protein N-terminus binding; ribonucleoprotein binding; SUMO ligase activity; ubiquitin protein ligase binding; ubiquitin-protein ligase activity; zinc ion binding. Biological Process: blood vessel development; blood vessel remodeling; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; establishment of protein localization; heart development; negative regulation of apoptosis; negative regulation of caspase activity; negative regulation of DNA damage response, signal transduction by p53 class mediator; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; peptidyl-lysine modification; positive regulation of cell cycle; positive regulation of mitotic cell cycle; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of protein export from nucleus; protein autoubiquitination; protein complex assembly; protein destabilization; protein ubiquitination; protein ubiquitination during ubiquitin-dependent protein catabolic process; proteolysis involved in cellular protein catabolic process; regulation of gene expression; regulation of heart rate; regulation of protein catabolic process; traversing start control point of mitotic cell cycle

size1 :

0.01 mg

price1 :

230 USD

size2 :

0.05 mg

price2 :

290

size3 :

0.1 mg

price3 :

455

size4 :

0.2 mg

price4 :

710

size5 :

0.5 mg

price5 :

1145

size6 :

1 mg

price6 :

1795

more info or order :

MyBioSource product webpage