catalog number :
MBS9420321
products type :
Recombinant Protein
products full name :
Recombinant Human Heterogeneous nuclear ribonucleoprotein A1
products short name :
[Heterogeneous nuclear ribonucleoprotein A1]
products name syn :
[Helix-destabilizing protein; Single-strand RNA-binding proteinhnRNP core protein A1]
other names :
[heterogeneous nuclear ribonucleoprotein A1 isoform a; Heterogeneous nuclear ribonucleoprotein A1; heterogeneous nuclear ribonucleoprotein A1; heterogeneous nuclear ribonucleoprotein A1; Helix-destabilizing protein; Single-strand RNA-binding protein; hnRNP core protein A1]
products gene name :
[ROA1]
other gene names :
[HNRNPA1; HNRNPA1; UP 1; ALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1; HNRPA1; hnRNP A1]
sequence positions :
[Partial of the Full Length of 2-372aa, 2-354aa]
sequence :
SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTL
TDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKV
DGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEE
HHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHD
SVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGR
SGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGG
GYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGY
GNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYN
DFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPR
NQG
purity :
Greater than 90% as determined by SDS-PAGE.
form :
20mM Tris-HCl based buffer, pH8.0
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
other info1 :
Target: ROA1
other info2 :
Tag Info: His-tag
products description :
Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly (A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May play a role in HCV RNA replication. Recombinant Protein
ncbi acc num :
NP_002127.1
ncbi gb acc num :
NM_002136.3
ncbi pathways :
Coregulation Of Androgen Receptor Activity Pathway (138085); Gene Expression Pathway (105937); Processing Of Capped Intron-Containing Pre-mRNA Pathway (160950); Spliceosome Pathway (125136); Spliceosome Pathway (124832); MRNA Splicing Pathway (105951); MRNA Splicing - Major Pathway (105952); MRNA Processing Pathway (198843)
ncbi summary :
This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome. [provided by RefSeq, Feb 2016]
uniprot summary :
hnRNP A1: Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May play a role in HCV RNA replication. Identified in the spliceosome C complex. Identified in a mRNP granule complex, at least composed of ACTB, ACTN4, DHX9, ERG, HNRNPA1, HNRNPA2B1, HNRNPAB, HNRNPD, HNRNPL, HNRNPR, HNRNPU, HSPA1, HSPA8, IGF2BP1, ILF2, ILF3, NCBP1, NCL, PABPC1, PABPC4, PABPN1, RPLP0, RPS3, RPS3A, RPS4X, RPS8, RPS9, SYNCRIP, TROVE2, YBX1 and untranslated mRNAs. Interacts with SEPT6. Interacts with HCV NS5B and with the 5'-UTR and 3'-UTR of HCV RNA. 3 isoforms of the human protein are produced by alternative splicing. Protein type: Nuclear export; RNA splicing; RNA-binding; Spliceosome. Chromosomal Location of Human Ortholog: 12q13.13. Cellular Component: cytoplasm; membrane; nucleoplasm; nucleus; ribonucleoprotein complex; spliceosome. Molecular Function: protein binding; protein domain specific binding; RNA binding; single-stranded DNA binding; single-stranded RNA binding. Biological Process: cellular response to glucose starvation; fibroblast growth factor receptor signaling pathway; mRNA processing; negative regulation of telomere maintenance via telomerase; nuclear export; nuclear import; nuclear mRNA splicing, via spliceosome; positive regulation of telomere maintenance via telomerase; regulation of alternative nuclear mRNA splicing, via spliceosome; RNA export from nucleus; RNA metabolic process. Disease: Amyotrophic Lateral Sclerosis 20; Inclusion Body Myopathy With Early-onset Paget Disease With Or Without Frontotemporal Dementia 3