product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant mouse Cathepsin K
catalog :
MBS9420154
quantity :
0.01 mg
price :
230 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9420154
products type :
Recombinant Protein
products full name :
Recombinant mouse Cathepsin K
products short name :
[Cathepsin K]
other names :
[cathepsin K preproprotein; Cathepsin K; cathepsin K; cathepsin K]
products gene name :
[CATK]
other gene names :
[Ctsk; Ctsk; catK; Ms10q; MMS10-Q; AI323530]
host :
E Coli
reactivity :
Mouse
sequence positions :
[Full Length, 115-329aa]
sequence :
PDSIDYRKKGYVTPVKNQGQCGSCWAFSSAGALEGQLKK
KTGKLLALSPQNLVDCVTENYGCGGGYMTTAFQYVQQNG
GIDSEDAYPYVGQDESCMYNATAKAAKCRGYREIPVGNE
KALKRAVARVGPISVSIDASLASFQFYSRGVYYDENCDR
DNVNHAVLVVGYGTQKGSKHWIIKNSWGESWGNKGYALL
ARNKNNACGITNMASFPKM
purity :
Greater than 90% as determined by SDS-PAGE.
form :
20mM Tris-HCl based buffer, pH8.0
storage stability :
Store at -2°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4° C for up to one week.
other info2 :
Tag Info: His-tag. Calculated MW: 27.5 KD
products description :
Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone rodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation.
ncbi gi num :
31982433
ncbi acc num :
NP_031828.2
ncbi gb acc num :
NM_007802.4
uniprot acc num :
P55097
ncbi pathways :
Activation Of Matrix Metalloproteinases Pathway (1367347); Apoptosis Pathway (83257); Apoptosis Pathway (470); Collagen Degradation Pathway (1367348); Degradation Of The Extracellular Matrix Pathway (1367346); Extracellular Matrix Organization Pathway (1367333); Immune System Pathway (1367472); Innate Immune System Pathway (1367502); Lysosome Pathway (99272); Lysosome Pathway (96865)
ncbi summary :
This gene encodes a member of the cathepsin family of cysteine proteases that is highly expressed in osteoclasts and is involved in the degradation of collagen and other matrix proteins in bone. The encoded preproprotein undergoes proteolytic processing to generate a mature, functional enzyme. Mice lacking the encoded protein exhibit phenotypic features of pycnodysostosis such as increased bone density and bone deformity, which become progressively more pronounced with age. [provided by RefSeq, Jan 2016]
uniprot summary :
CTSK: Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation. Defects in CTSK are the cause of pycnodysostosis (PKND). PKND is an autosomal recessive osteochondrodysplasia characterized by osteosclerosis and short stature. Belongs to the peptidase C1 family. Protein type: EC 3.4.22.38; Protease. Chromosomal Location of Human Ortholog: 3 F2.1 3 40.74 cM. Cellular Component: cytoplasm; extracellular space; intracellular membrane-bound organelle; lysosome; nucleoplasm. Molecular Function: collagen binding; cysteine-type endopeptidase activity; fibronectin binding; proteoglycan binding. Biological Process: bone resorption; collagen catabolic process; proteolysis involved in cellular protein catabolic process
size1 :
0.01 mg
price1 :
230 USD
size2 :
0.05 mg
price2 :
290
size3 :
0.1 mg
price3 :
455
size4 :
0.2 mg
price4 :
710
size5 :
0.5 mg
price5 :
1145
size6 :
1 mg
price6 :
1795
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!