product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant mouse Complement C1q subcomponent subunit A
catalog :
MBS9420053
quantity :
0.01 mg
price :
230 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS9420053
products type :
Recombinant Protein
products full name :
Recombinant mouse Complement C1q subcomponent subunit A
products short name :
[Complement C1q subcomponent subunit A]
other names :
[complement C1q subcomponent subunit A; Complement C1q subcomponent subunit A; complement C1q subcomponent subunit A; complement component 1, q subcomponent, alpha polypeptide]
products gene name :
[C1QA]
other gene names :
[C1qa; C1qa; C1q; AI255395]
host :
E Coli
reactivity :
Mouse
sequence positions :
[23-245aa]
sequence :
EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRT
GIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLK
GVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTN
QESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSS
SGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWI
EKDPAKGRIYQGTEADSIFSGFLIFPSA
purity :
Greater than 90% as determined by SDS-PAGE.
form :
20mM Tris-HCl based buffer, pH8.0
storage stability :
Store at -20°C, for extended storage, conserve at -20°C or -80°C. Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
other info1 :
Calculated MW: 39.5 kD
other info2 :
Tag Info: His-SUMO-tag
products description :
Recombinant Protein. C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complent syst. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
ncbi gi num :
124286805
ncbi acc num :
NP_031598.2
ncbi gb acc num :
NM_007572.2
uniprot acc num :
P98086
ncbi pathways :
Chagas Disease (American Trypanosomiasis) Pathway (147810); Chagas Disease (American Trypanosomiasis) Pathway (147795); Classical Antibody-mediated Complement Activation Pathway (575152); Complement Activation, Classical Pathway (198379); Complement And Coagulation Cascades Pathway (198335); Complement And Coagulation Cascades Pathway (83270); Complement And Coagulation Cascades Pathway (484); Complement Cascade Pathway (575148); Creation Of C4 And C2 Activators Pathway (575150); Immune System Pathway (575095)
uniprot summary :
C1QA: C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca(2 )-dependent C1r(2)C1s(2) proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 4 D3 4 69.05 cM. Cellular Component: extracellular space. Molecular Function: protein binding. Biological Process: complement activation, classical pathway
size1 :
0.01 mg
price1 :
230 USD
size2 :
0.05 mg
price2 :
290
size3 :
0.1 mg
price3 :
455
size4 :
0.2 mg
price4 :
710
size5 :
0.5 mg
price5 :
1145
size6 :
1 mg
price6 :
1795
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!