catalog number :
MBS9419964
products type :
Recombinant Protein
products full name :
Recombinant Human 3-ketoacyl-CoA thiolase, mitochondrial
products short name :
[3-ketoacyl-CoA thiolase]
products name syn :
[Acetyl-CoA acyltrans ferase; Beta-ketothiolase, Mitochondrial 3-oxoacyl-CoA thiolase; T1]
other names :
[3-ketoacyl-CoA thiolase, mitochondrial; 3-ketoacyl-CoA thiolase, mitochondrial; 3-ketoacyl-CoA thiolase, mitochondrial; acetyl-CoA acyltransferase 2; Acetyl-CoA acyltransferase; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; T1]
products gene name :
[THIM]
other gene names :
[ACAA2; ACAA2; DSAEC]
sequence positions :
[Full Length, 17-397aa]
purity :
Greater than 90% as determined by SDS-PAGE.
form :
20mM Tris-HCl based buffer, pH8.0
storage stability :
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months
at -20°C,-80°C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
other info1 :
Tag Info: N-terminal 6xHis-tagged. Calculated MW: 44.2 kDa.
other info2 :
CGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAE.
NLAVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKK.
DGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMGIGPVPAISGALKKAGLSLKDMDL.
VEVNEAFAPQYLAVERSLDLDISKTNVNGGAIALGHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAV.
IIQSTA
FGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVI
MGNVLQSSSDAIYLARHVGLRVGIPKETPALTINRL.
Target Sequence:
products description :
Abolishes BNIP3-mediated apoptosis and mitochondrial damage.
ncbi acc num :
NP_006102.2
ncbi gb acc num :
NP_006102.2
ncbi pathways :
Fatty Acid Biosynthesis Pathway (198873); Fatty Acid Biosynthesis, Elongation, Mitochondria Pathway (413380); Fatty Acid Biosynthesis, Elongation, Mitochondria Pathway (468246); Fatty Acid Degradation Pathway (82935); Fatty Acid Degradation Pathway (296); Fatty Acid Elongation Pathway (82934); Fatty Acid Elongation Pathway (295); Fatty Acid Metabolism Pathway (868084); Fatty Acid Metabolism Pathway (878045); Metabolic Pathways (132956)
ncbi summary :
The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. [provided by RefSeq, Jul 2008]
uniprot summary :
ACAA2: Abolishes BNIP3-mediated apoptosis and mitochondrial damage. Belongs to the thiolase family. Protein type: Amino Acid Metabolism - valine, leucine and isoleucine degradation; EC 2.3.1.16; Lipid Metabolism - fatty acid; Lipid Metabolism - fatty acid elongation in mitochondria; Transferase. Chromosomal Location of Human Ortholog: 18q21.1. Cellular Component: mitochondrial matrix; mitochondrion. Molecular Function: acetyl-CoA C-acyltransferase activity; protein binding; RNA binding. Biological Process: fatty acid beta-oxidation