product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
CYSLTR1 Polyclonal Antibody
catalog :
MBS9135582
quantity :
0.05 mL
price :
200 USD
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
more info or order :
image
image 1 :
MyBioSource MBS9135582 image 1
Western blot analysis of extracts of various cell lines, using CYSLTR1 antibody (MBS9135582) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
product information
catalog number :
MBS9135582
products type :
Antibody
products full name :
CYSLTR1 Polyclonal Antibody
products short name :
[CYSLTR1]
products name syn :
[CYSLTR1; CYSLT1; CYSLT1R; CYSLTR; HMTMF81; cysteinyl leukotriene receptor 1]
other names :
[cysteinyl leukotriene receptor 1; Cysteinyl leukotriene receptor 1; cysteinyl leukotriene receptor 1; cysteinyl leukotriene receptor 1; Cysteinyl leukotriene D4 receptor; LTD4 receptor; G-protein coupled receptor HG55; HMTMF81]
products gene name :
[CYSLTR1]
other gene names :
[CYSLTR1; CYSLTR1; CYSLT1; CYSLTR; CYSLT1R; HMTMF81; CYSLT1; CysLTR1; LTD4 receptor]
clonality :
Polyclonal
isotype :
IgG
host :
Rabbit
reactivity :
Human, Mouse, Rat
sequence length :
337
sequence :
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFF
GNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPL
RVVYYVHKGIWLFGDFLCRLST
purity :
Affinity Purification
form :
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
storage stability :
Store at -20 degree C. Avoid freeze / thaw cycles.
tested application :
Western Blot (WB)
app notes :
WB: 1:500 - 1:2000
image1 heading :
Western Blot (WB)
other info1 :
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYSLTR1 (NP_006630.1).
products categories :
Polyclonal Antibodies
products description :
This gene encodes a member of the G-protein coupled receptor 1 family. The encoded protein is a receptor for cysteinyl leukotrienes, and is involved in mediating bronchoconstriction via activation of a phosphatidylinositol-calcium second messenger system. Activation of the encoded receptor results in contraction and proliferation of bronchial smooth muscle cells, eosinophil migration, and damage to the mucus layer in the lung. Upregulation of this gene is associated with asthma and dysregulation may also be implicated in cancer. Alternative splicing results in multiple transcript variants.
ncbi gi num :
532164733
ncbi acc num :
NP_001269115.1
ncbi gb acc num :
NM_001282186.1
uniprot acc num :
Q9Y271
ncbi mol weight :
Calculated: 38kDa. Observed: 38kDa
ncbi pathways :
Calcium Signaling Pathway (83050); Calcium Signaling Pathway (459); Class A/1 (Rhodopsin-like Receptors) Pathway (1269545); Eicosanoid Ligand-binding Receptors Pathway (1269560); Endothelins Pathway (137958); G Alpha (q) Signalling Events Pathway (1269578); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544); GPCRs, Class A Rhodopsin-like Pathway (198886); Gastrin-CREB Signalling Pathway Via PKC And MAPK (1269592)
ncbi summary :
This gene encodes a member of the G-protein coupled receptor 1 family. The encoded protein is a receptor for cysteinyl leukotrienes, and is involved in mediating bronchoconstriction via activation of a phosphatidylinositol-calcium second messenger system. Activation of the encoded receptor results in contraction and proliferation of bronchial smooth muscle cells, eosinophil migration, and damage to the mucus layer in the lung. Upregulation of this gene is associated with asthma and dysregulation may also be implicated in cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
uniprot summary :
Receptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4.
size1 :
0.05 mL
price1 :
200 USD
size2 :
0.1 mL
price2 :
275
size3 :
0.2 mL
price3 :
430
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!