catalog number :
MBS9135582
products full name :
CYSLTR1 Polyclonal Antibody
products short name :
[CYSLTR1]
products name syn :
[CYSLTR1; CYSLT1; CYSLT1R; CYSLTR; HMTMF81; cysteinyl leukotriene receptor 1]
other names :
[cysteinyl leukotriene receptor 1; Cysteinyl leukotriene receptor 1; cysteinyl leukotriene receptor 1; cysteinyl leukotriene receptor 1; Cysteinyl leukotriene D4 receptor; LTD4 receptor; G-protein coupled receptor HG55; HMTMF81]
products gene name :
[CYSLTR1]
other gene names :
[CYSLTR1; CYSLTR1; CYSLT1; CYSLTR; CYSLT1R; HMTMF81; CYSLT1; CysLTR1; LTD4 receptor]
reactivity :
Human, Mouse, Rat
sequence :
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFF
GNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPL
RVVYYVHKGIWLFGDFLCRLST
purity :
Affinity Purification
form :
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
storage stability :
Store at -20 degree C. Avoid freeze / thaw cycles.
tested application :
Western Blot (WB)
app notes :
WB: 1:500 - 1:2000
image1 heading :
Western Blot (WB)
other info1 :
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYSLTR1 (NP_006630.1).
products categories :
Polyclonal Antibodies
products description :
This gene encodes a member of the G-protein coupled receptor 1 family. The encoded protein is a receptor for cysteinyl leukotrienes, and is involved in mediating bronchoconstriction via activation of a phosphatidylinositol-calcium second messenger system. Activation of the encoded receptor results in contraction and proliferation of bronchial smooth muscle cells, eosinophil migration, and damage to the mucus layer in the lung. Upregulation of this gene is associated with asthma and dysregulation may also be implicated in cancer. Alternative splicing results in multiple transcript variants.
ncbi acc num :
NP_001269115.1
ncbi gb acc num :
NM_001282186.1
ncbi mol weight :
Calculated: 38kDa. Observed: 38kDa
ncbi pathways :
Calcium Signaling Pathway (83050); Calcium Signaling Pathway (459); Class A/1 (Rhodopsin-like Receptors) Pathway (1269545); Eicosanoid Ligand-binding Receptors Pathway (1269560); Endothelins Pathway (137958); G Alpha (q) Signalling Events Pathway (1269578); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544); GPCRs, Class A Rhodopsin-like Pathway (198886); Gastrin-CREB Signalling Pathway Via PKC And MAPK (1269592)
ncbi summary :
This gene encodes a member of the G-protein coupled receptor 1 family. The encoded protein is a receptor for cysteinyl leukotrienes, and is involved in mediating bronchoconstriction via activation of a phosphatidylinositol-calcium second messenger system. Activation of the encoded receptor results in contraction and proliferation of bronchial smooth muscle cells, eosinophil migration, and damage to the mucus layer in the lung. Upregulation of this gene is associated with asthma and dysregulation may also be implicated in cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
uniprot summary :
Receptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4.