product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
MS4A7 Polyclonal Antibody
catalog :
MBS9135481
quantity :
0.05 mL
price :
200 USD
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS9135481 image 1
Western blot analysis of extracts of mouse spleen, using MS4A7 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
product information
catalog number :
MBS9135481
products type :
Antibody
products full name :
MS4A7 Polyclonal Antibody
products short name :
[MS4A7]
products name syn :
[4SPAN2; CD20L4; CFFM4; MS4A8]
other names :
[membrane-spanning 4-domains subfamily A member 7 isoform 1; Membrane-spanning 4-domains subfamily A member 7; membrane-spanning 4-domains subfamily A member 7; membrane spanning 4-domains A7; CD20 antigen-like 4; CD20/FC-epsilon-RI-beta family member 4; Four-span transmembrane protein 2]
products gene name :
[MS4A7]
other gene names :
[MS4A7; MS4A7; CFFM4; MS4A8; 4SPAN2; CD20L4; 4SPAN2; CD20L4; CFFM4]
clonality :
Polyclonal
isotype :
IgG
host :
Rabbit
reactivity :
Mouse
sequence length :
240
sequence :
SLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADS
MVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLT
SVSLTGVLVVMLIFTVLELLLAA
purity :
Affinity Purification
storage stability :
Store at -20°C. Avoid freeze / thaw cycles.
tested application :
Western Blot (WB)
app notes :
WB: 1:200 - 1:2000
image1 heading :
Western Blot (WB)
other info1 :
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A7 (NP_067024.1)
other info2 :
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Cellular Location: Membrane, Multi-pass membrane protein. Positive Samples: Mouse spleen
products categories :
Polyclonal Antibodies
products description :
This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed.
ncbi gi num :
11139299
ncbi acc num :
NP_067024.1
ncbi gb acc num :
NM_021201.4
uniprot acc num :
Q9GZW8
ncbi mol weight :
Calculated: 21kDa; 26kDa. Observed: 26kDa
ncbi summary :
This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
uniprot summary :
May be involved in signal transduction as a component of a multimeric receptor complex.
size1 :
0.05 mL
price1 :
200 USD
size2 :
0.1 mL
price2 :
275
size3 :
0.2 mL
price3 :
430
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!