product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
SUV420H1 Polyclonal Antibody
catalog :
MBS9135428
quantity :
0.05 mL
price :
200 USD
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
more info or order :
MyBioSource product webpage
image
image 1 :
MyBioSource MBS9135428 image 1
Western blot analysis of extracts of various cell lines, using SUV420H1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
product information
catalog number :
MBS9135428
products type :
Antibody
products full name :
SUV420H1 Polyclonal Antibody
products short name :
[SUV420H1]
products name syn :
[CGI-85; CGI85; SUV420H1]
other names :
[histone-lysine N-methyltransferase KMT5B isoform 5; Histone-lysine N-methyltransferase KMT5B; histone-lysine N-methyltransferase KMT5B; lysine methyltransferase 5B; Lysine N-methyltransferase 5B; Lysine-specific methyltransferase 5B]
products gene name :
[SUV420H1]
other gene names :
[KMT5B; KMT5B; CGI85; MRD51; CGI-85; SUV420H1; Su(var)4-20 homolog 1; Suv4-20h1]
clonality :
Polyclonal
isotype :
IgG
host :
Rabbit
reactivity :
Human, Mouse, Rat
sequence length :
370
sequence :
MNTSAFPSRSSRHFSKSDSFSHNNPVRFRPIKGRQEELK
EVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKL
FKEHVFIYLRMFATDSGFEILPC
purity :
Affinity Purification
form :
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
storage stability :
Store at -20 degree C. Avoid freeze / thaw cycles.
tested application :
Western Blot (WB)
app notes :
WB: 1:200 - 1:2000
image1 heading :
Western Blot (WB)
other info1 :
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SUV420H1 (NP_060105.3)
products categories :
Polyclonal Antibodies
products description :
This gene encodes a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
ncbi gi num :
665506000
ncbi acc num :
NP_001287838.1
ncbi gb acc num :
NM_001300909.1
uniprot acc num :
Q4FZB7
ncbi mol weight :
Calculated: 31kDa; 44kDa; 99kDa. Observed: 110kDa
ncbi pathways :
Glucocorticoid Receptor Regulatory Network Pathway (138014); Lysine Degradation Pathway (82956); Lysine Degradation Pathway (320)
ncbi summary :
This gene encodes a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
uniprot summary :
Histone methyltransferase that specifically trimethylates 'Lys-20' of histone H4. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. Mainly functions in pericentric heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin in these regions. KMT5B is targeted to histone H3 via its interaction with RB1 family proteins (RB1, RBL1 and RBL2) (). Plays a role in myogenesis by regulating the expression of target genes, such as EID3.
size1 :
0.05 mL
price1 :
200 USD
size2 :
0.1 mL
price2 :
275
size3 :
0.2 mL
price3 :
430
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!