antibody

CCL5 Polyclonal Antibody

MBS9134202

0.05 mL

200 USD

polyclonal

rabbit

nonconjugated

human, mouse, rat

Antibody

CCL5 Polyclonal Antibody

[CCL5]

[D17S136E; eoCP; RANTES; SCYA5; SIS-delta; SISd; TCP228]

[C-C motif chemokine 5 isoform 1; C-C motif chemokine 5; C-C motif chemokine 5; C-C motif chemokine ligand 5; EoCP; Eosinophil chemotactic cytokine; SIS-delta; Small-inducible cytokine A5; T cell-specific protein P228; TCP228]

[CCL5]

[CCL5; CCL5; SISd; eoCP; SCYA5; RANTES; TCP228; D17S136E; SIS-delta; D17S136E; SCYA5; TCP228]

Polyclonal

IgG

Rabbit

Human, Mouse, Rat

91

SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAV
VFVTRKNRQVCANPEKKWVREYINSLEMS

Affinity Purification

Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

WB: 1:500 - 1:2000

Immunogen: Recombinant funsion protein containing a sequence corresponding to amino acid 24-91 of human CCL5. Immunogen Species: Human

Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Cellular Location: Secreted

Polyclonal Antibodies

This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms.

22538814

NP_002976.2

NM_002985.2

P13501

9kDa

Chagas Disease (American Trypanosomiasis) Pathway (147809); Chagas Disease (American Trypanosomiasis) Pathway (147795); Chemokine Receptors Bind Chemokines Pathway (106359); Chemokine Signaling Pathway (99051); Chemokine Signaling Pathway (96864); Class A/1 (Rhodopsin-like Receptors) Pathway (106357); Cytokine-cytokine Receptor Interaction Pathway (83051); Cytokine-cytokine Receptor Interaction Pathway (460); Cytosolic DNA-sensing Pathway (125137); Cytosolic DNA-sensing Pathway (124833)

This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Jul 2013]

Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils (PubMed:16791620, PubMed:1380064, PubMed:8525373, PubMed:9516414, PubMed:15923218). May also be an agonist of the G protein-coupled receptor GPR75, stimulating inositol trisphosphate production and calcium mobilization through its activation. Together with GPR75, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. By activating GPR75 may also play a role in insulin secretion by islet cells (PubMed:23979485).

0.05 mL

200 USD

0.1 mL

275

0.2 mL

430