catalog number :
MBS9133861
products full name :
CSAD Polyclonal Antibody
products short name :
[CSAD]
products name syn :
[CSD; PCAP]
other names :
[cysteine sulfinic acid decarboxylase isoform 2; Cysteine sulfinic acid decarboxylase; cysteine sulfinic acid decarboxylase; cysteine sulfinic acid decarboxylase; Cysteine-sulfinate decarboxylase; Sulfinoalanine decarboxylase]
products gene name :
[CSAD]
other gene names :
[CSAD; CSAD; CSD; PCAP; CSD]
sequence :
DVALDTGDKVVQCGRRVDCLKLWLMWKAQGDQGLERRID
QAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPSL
RGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGT
RGNFFRVVVANSALTCADMDFLLNELERLGQDL
purity :
Affinity Purification
storage stability :
Store at -20°C. Avoid freeze / thaw cycles.
tested application :
Western Blot (WB)
app notes :
WB: 1:500 - 1:2000
image1 heading :
Western Blot (WB)
other info1 :
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 371-520 of human CSAD (NP_057073.4)
other info2 :
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Calculated: 38kDa; 55kDa; 58kDa. Observed: 55kDa
products categories :
Polyclonal Antibodies
products description :
This gene encodes a member of the group 2 decarboxylase family. A similar protein in rodents plays a role in multiple biological processes as the rate-limiting enzyme in taurine biosynthesis, catalyzing the decarboxylation of cysteinesulfinate to hypotaurine. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
ncbi acc num :
NP_001231634.1
ncbi gb acc num :
NM_001244705.1
ncbi pathways :
Degradation Of Cysteine And Homocysteine Pathway (530755); Metabolism Pathway (477135); Metabolism Of Amino Acids And Derivatives Pathway (106169); Sulfur Amino Acid Metabolism Pathway (530753); Taurine And Hypotaurine Metabolism Pathway (82967); Taurine And Hypotaurine Metabolism Pathway (336); Taurine Biosynthesis Pathway (545268)
ncbi summary :
This gene encodes a member of the group 2 decarboxylase family. A similar protein in rodents plays a role in multiple biological processes as the rate-limiting enzyme in taurine biosynthesis, catalyzing the decarboxylation of cysteinesulfinate to hypotaurine. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]