catalog number :
MBS9133856
products full name :
CRACR2A Polyclonal Antibody
products short name :
[CRACR2A]
products name syn :
[EFCAB4B]
other names :
[EF-hand calcium-binding domain-containing protein 4B isoform a; EF-hand calcium-binding domain-containing protein 4B; EF-hand calcium-binding domain-containing protein 4B; calcium release activated channel regulator 2A; Calcium release-activated calcium channel regulator 2A; CRAC channel regulator 2A; Calcium release-activated channel regulator 2A]
products gene name :
[CRACR2A]
other gene names :
[CRACR2A; CRACR2A; EFCAB4B; EFCAB4B; CRAC channel regulator 2A]
reactivity :
Human, Mouse
sequence :
MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQK
ETQEQTSGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRL
HKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFF
FSQNNPSQEDAGEQVAQRHEEKVYLSRGDEDLGDMGEDE
EAQFRMLMDRLGAQKVLEDESDVKQLWLQLKKEEPHLLS
NFEDF
purity :
Affinity Purification
storage stability :
Store at -20 degree C. Avoid freeze / thaw cycles.
tested application :
Western Blot (WB), Immunohistochemistry (IHC)
app notes :
WB: 1:500 - 1:2000. IHC: 1:50 - 1:200
image1 heading :
Western Blot (WB)
image2 heading :
Immunohistochemistry (IHC)
other info1 :
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CRACR2A (NP_001138430.1).
other info2 :
Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Cellular Location: Cytoplasm. Positive Samples: HeLa, Mouse liver, Rat liver
products categories :
Polyclonal Antibodies
ncbi acc num :
NP_001138430.1
ncbi gb acc num :
NM_001144958.1
ncbi mol weight :
Calculated: 45kDa; 83kDa. Observed: 45kDa
uniprot summary :
Ca2+-binding protein that plays a key role in store-operated Ca2+ entry (SOCE) in T-cells by regulating CRAC channel activation. Acts as a cytoplasmic calcium-sensor that facilitates the clustering of ORAI1 and STIM1 at the junctional regions between the plasma membrane and the endoplasmic reticulum upon low Ca2+ concentration. It thereby regulates CRAC channel activation, including translocation and clustering of ORAI1 and STIM1. Upon increase of cytoplasmic Ca2+ resulting from opening of CRAC channels, dissociates from ORAI1 and STIM1, thereby destabilizing the ORAI1-STIM1 complex.