NMNAT2 Polyclonal Antibody | MyBioSource MBS9133850 product information

product summary

company name :

MyBioSource

product type :

antibody

product name :

NMNAT2 Polyclonal Antibody

catalog :

MBS9133850

quantity :

0.05 mL

price :

200 USD

clonality :

polyclonal

host :

rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

more info or order :

MyBioSource product webpage

image

image 1 :

Western blot analysis of extracts of various cell lines, using NMNAT2 antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.

product information

catalog number :

MBS9133850

products type :

Antibody

products full name :

NMNAT2 Polyclonal Antibody

products short name :

[NMNAT2]

products name syn :

[NMNAT2; C1orf15; PNAT2; nicotinamide nucleotid e adenylyltransferase 2]

other names :

[nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 isoform 1; Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2; nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2; nicotinamide nucleotide adenylyltransferase 2; Nicotinamide mononucleotide adenylyltransferase 2; NMN adenylyltransferase 2; Nicotinate-nucleotide adenylyltransferase 2; NaMN adenylyltransferase 2]

products gene name :

[NMNAT2]

other gene names :

[NMNAT2; NMNAT2; PNAT2; C1orf15; C1orf15; KIAA0479; NMN/NaMN adenylyltransferase 2; NMN adenylyltransferase 2; NaMN adenylyltransferase 2]

clonality :

Polyclonal

isotype :

IgG

host :

Rabbit

reactivity :

Human, Mouse, Rat

sequence length :

307

sequence :

MEIQELEEIQACQGLWEVFVTLSERARDYLHKTGRFIVI
GGIVSPVHDSYGKQGLVSSRHRLIMCQLAVQNSDWIRVD
PWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTPSM
TPVIGQPQNETPQPIYQNSNVATKPTAAKILGKVGESLS
RICCVRPPVERFTFVDENANLGTVMRYEEIELRILLLCG
SDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDR
IMNHSSILRKYKNNIMVVKDD

purity :

Affinity Purification

storage stability :

Store at -20°C. Avoid freeze / thaw cycles.

tested application :

Western Blot (WB)

app notes :

WB: 1:500 - 1:2000

image1 heading :

Western Blot (WB)

other info1 :

Immunogen: Recombinant fusion protein containing a sequence correspondind to amino acids 1-302 of human NMAT2 (NP_733820.1)

other info2 :

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Cellular Location: Cytoplasm, Golgi apparatus. Positive Samples: U-87MG, H460, BxPC3, Mouse pancreas, Rat brain. Calculated MW: 34kDa. Observed MW: 37kDa

products categories :

Polyclonal Antibodies

products description :

This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus, and is ubiquitously expressed; this enzyme is cytoplasmic, and is predominantly expressed in the brain. Two transcript variants encoding different isoforms have been found for this gene.

ncbi gi num :

24307989

ncbi acc num :

NP_055854.1

ncbi gb acc num :

NM_015039.3

uniprot acc num :

Q9BZQ4

ncbi pathways :

Defective AMN Causes Hereditary Megaloblastic Anemia 1 Pathway (906000); Defective BTD Causes Biotidinase Deficiency Pathway (906015); Defective CD320 Causes Methylmalonic Aciduria Pathway (906012); Defective CUBN Causes Hereditary Megaloblastic Anemia 1 Pathway (906001); Defective GIF Causes Intrinsic Factor Deficiency Pathway (906004); Defective HLCS Causes Multiple Carboxylase Deficiency Pathway (906014); Defective LMBRD1 Causes Methylmalonic Aciduria And Homocystinuria Type CblF Pathway (906003); Defective MMAA Causes Methylmalonic Aciduria Type CblA Pathway (906010); Defective MMAB Causes Methylmalonic Aciduria Type CblB Pathway (906009); Defective MMACHC Causes Methylmalonic Aciduria And Homocystinuria Type CblC Pathway (906005)

ncbi summary :

uniprot summary :

Catalyzes the formation of NAD+ from nicotinamide mononucleotide (NMN) and ATP. Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate but with a lower efficiency. Cannot use triazofurin monophosphate (TrMP) as substrate. Also catalyzes the reverse reaction, i.e. the pyrophosphorolytic cleavage of NAD+. For the pyrophosphorolytic activity prefers NAD+, NADH and NaAD as substrates and degrades nicotinic acid adenine dinucleotide phosphate (NHD) less effectively. Fails to cleave phosphorylated dinucleotides NADP+, NADPH and NaADP+.

size1 :

0.05 mL

price1 :

200 USD

size2 :

0.1 mL

price2 :

275

size3 :

0.2 mL

price3 :

430

more info or order :

MyBioSource product webpage