product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
PEG3 Polyclonal Antibody
catalog :
MBS9132926
quantity :
0.05 mL
price :
200 USD
clonality :
polyclonal
host :
rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot
more info or order :
product information
catalog number :
MBS9132926
products type :
Antibody
products full name :
PEG3 Polyclonal Antibody
products short name :
[PEG3]
products name syn :
[PW1; ZKSCAN22; ZNF904; ZSCAN24; paternally expressed 3]
other names :
[paternally-expressed gene 3 protein isoform 1; Paternally-expressed gene 3 protein; paternally-expressed gene 3 protein; paternally expressed 3; Zinc finger and SCAN domain-containing protein 24]
products gene name :
[PEG3]
other gene names :
[PEG3; PEG3; PW1; ZNF904; ZSCAN24; ZKSCAN22; KIAA0287; ZSCAN24]
clonality :
Polyclonal
isotype :
IgG
host :
Rabbit
reactivity :
Mouse
sequence length :
1588
sequence :
MLPPKHLSATKPKKSWAPNLYELDSDLTKEPDVIIGEGP
TDSEFFHQRFRNLIYVEFVGPRKTLIKLRNLCLDWLQPE
TRTKEEIIELLVLEQYLTIIPEKLKPWVRAKKPENCEKL
VTLLENYKEMYQPEDDNNSDVTSDDDMTRNRRESSPPHS
VHSFSDRDWDRRGRSRDMEPRDRWSHTRNPRSRMPPRDL
SLPVVAKTSFEMDREDDRDSRAYESRSQDAESYQNVVDL
AEDRKPHNTIQDNMENYRKLL
TDSEFFHQRFRNLIYVEFVGPRKTLIKLRNLCLDWLQPE
TRTKEEIIELLVLEQYLTIIPEKLKPWVRAKKPENCEKL
VTLLENYKEMYQPEDDNNSDVTSDDDMTRNRRESSPPHS
VHSFSDRDWDRRGRSRDMEPRDRWSHTRNPRSRMPPRDL
SLPVVAKTSFEMDREDDRDSRAYESRSQDAESYQNVVDL
AEDRKPHNTIQDNMENYRKLL
purity :
Affinity Purification
form :
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
storage stability :
Store at -20°C. Avoid freeze / thaw cycles.
tested application :
Western Blot (WB)
app notes :
WB: 1:500 - 1:2000
other info1 :
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PEG3 (NP_006201.1).
other info2 :
Calculated MW: 60kDa/165kDa/166kDa/180kDa
products categories :
Polyclonal Antibodies
products description :
In human, ZIM2 and PEG3 are treated as two distinct genes though they share multiple 5' exons and a common promoter and both genes are paternally expressed (PMID:15203203). Alternative splicing events connect their shared 5' exons either with the remaining 4 exons unique to ZIM2, or with the remaining 2 exons unique to PEG3. In contrast, in other mammals ZIM2 does not undergo imprinting and, in mouse, cow, and likely other mammals as well, the ZIM2 and PEG3 genes do not share exons. Human PEG3 protein belongs to the Kruppel C2H2-type zinc finger protein family. PEG3 may play a role in cell proliferation and p53-mediated apoptosis. PEG3 has also shown tumor suppressor activity and tumorigenesis in glioma and ovarian cells. Alternative splicing of this PEG3 gene results in multiple transcript variants encoding distinct isoforms.
ncbi gi num :
226053126
ncbi acc num :
NP_001139656.1
ncbi gb acc num :
NM_001146184.1
uniprot acc num :
Q9GZU2
ncbi pathways :
Gene Expression Pathway (105937); Generic Transcription Pathway (105938); TNF-alpha/NF-kB Signaling Pathway (198884)
ncbi summary :
In human, ZIM2 and PEG3 are treated as two distinct genes though they share multiple 5' exons and a common promoter and both genes are paternally expressed (PMID:15203203). Alternative splicing events connect their shared 5' exons either with the remaining 4 exons unique to ZIM2, or with the remaining 2 exons unique to PEG3. In contrast, in other mammals ZIM2 does not undergo imprinting and, in mouse, cow, and likely other mammals as well, the ZIM2 and PEG3 genes do not share exons. Human PEG3 protein belongs to the Kruppel C2H2-type zinc finger protein family. PEG3 may play a role in cell proliferation and p53-mediated apoptosis. PEG3 has also shown tumor suppressor activity and tumorigenesis in glioma and ovarian cells. Alternative splicing of this PEG3 gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Sep 2009]
uniprot summary :
Induces apoptosis in cooperation with SIAH1A. Acts as a mediator between p53/TP53 and BAX in a neuronal death pathway that is activated by DNA damage. Acts synergistically with TRAF2 and inhibits TNF induced apoptosis through activation of NF-kappa-B (). Possesses a tumor suppressing activity in glioma cells.
size1 :
0.05 mL
price1 :
200 USD
size2 :
0.1 mL
price2 :
275
size3 :
0.2 mL
price3 :
430
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!