product summary
Loading...
company name :
MyBioSource
product type :
antibody
product name :
GLP2 antibody
catalog :
MBS838754
quantity :
0.2 mL
price :
575 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
[M81404]
application :
ELISA, enzyme immunoassay
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS838754
products type :
Antibody
products full name :
GLP2 antibody
products short name :
[GLP2]
products name syn :
[Monoclonal GLP2; Anti-GLP2; Glucagon-like peptide-2; GLP 2; GLP-2]
products gene name :
[GLP2]
clonality :
Monoclonal
isotype :
IgG1 kappa
clone :
[M81404]
host :
Mouse
reactivity :
Human
specificity :
It is specific for human GLP2
purity :
GLP2 antibody was purified from cell culture supernatant by protein A/G chromatography
form :
Supplied in 0.01 M phosphate buffer, pH 7.4, containing 0.5 M NaCl and 15 mM sodium azide
concentration :
1.01mg/ml
storage stability :
Store at 4 degree C without exposure to light.
tested application :
ELISA (EIA)
other info1 :
Biological Significance: GLP2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).
other info2 :
Immunogen: GLP2 antibody was raised in Mouse using Synthetic GLP2 peptide as the immunogen
products categories :
Hormones & Steroids
products description :
Mouse monoclonal GLP2 antibody
size1 :
0.2 mL
price1 :
575 USD
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!