Wnt3a protein (Mouse) | MyBioSource MBS837831 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Wnt3a protein (Mouse)

catalog :

MBS837831

quantity :

0.01 mg

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS837831

products type :

Recombinant Protein

products full name :

Wnt3a protein (Mouse)

products short name :

Wnt3a

products name syn :

Wnta-3 protein; wingless-type MMTV integration site family protein; Wnta 3 protein; WNT member 3A protein

other names :

WNT3A; Protein Wnt-3a; protein Wnt-3a; wingless-type MMTV integration site family, member 3A

products gene name :

Wnt3a

other gene names :

WNT3A; WNT3A

uniprot entry name :

WNT3A_HUMAN

host :

E. Coli

sequence length :

352

sequence :

HQFRGRRWN CTTVSNSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSAAICGC SSRLQGSPGEGWKWGGCS EDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASH MHLKCKCHGLSGSCEVKTCWWSQPDFR TIGDFLKDKYDSASEMVVEKHRESRGWVETLRP RYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRD RTCNVSSHGIDGCDLLCCGRGHNA RTERRREKCHCVFHWCCYVSCQECTRVYDVHTCK
SYPIWWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCR
NYVEIMPSVAEGVKAGIQECQ
AA sequence (19-352):

purity :

> 90% by SDS-PAGE

form :

Liquid in 20mM Tris-HCl, pH8.0 with 500mM Arg and 50% glycerol.

concentration :

0.125 mg/ml

storage stability :

4 degree C shipping only. Upon receipt store at -20 degree C to -80 degree C. Avoid repeat freeze-thaw cycles.

other info1 :

Protein Type: Recombinant. Biological Significance: Wnt3ais a ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube.

other info2 :

Biohazard: Use standard laboratory precautions when handling this material.

products categories :

Signal Transduction

products description :

Purified recombinant Wnt3a protein (Mouse)

ncbi gi num :

14530679

ncbi acc num :

BAB61052.1

ncbi mol weight :

42,905 Da

ncbi pathways :

Basal Cell Carcinoma Pathway (83113); Basal Cell Carcinoma Pathway (525); Canonical Wnt Signaling Pathway (138032); Cardiac Progenitor Differentiation Pathway (712094); Class B/2 (Secretin Family Receptors) Pathway (106378); DNA Damage Response (only ATM Dependent) Pathway (198827); Disease Pathway (530764); Diseases Of Signal Transduction Pathway (1183518); GPCR Ligand Binding Pathway (161020); HTLV-I Infection Pathway (373901)

ncbi summary :

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 96% amino acid identity to mouse Wnt3A protein, and 84% to human WNT3 protein, another WNT gene product. This gene is clustered with WNT14 gene, another family member, in chromosome 1q42 region. [provided by RefSeq, Jul 2008]

uniprot summary :

WNT3A: Ligand for members of the frizzled family of seven transmembrane receptors. Wnt-3 and Wnt-3a play distinct roles in cell-cell signaling during morphogenesis of the developing neural tube. Interacts with PORCN. Interacts with APCDD1 and WLS. Component of the Wnt-Fzd-LRP5-LRP6 signaling complex that contains a WNT protein, a FZD protein and LRP5 or LRP6. Interacts directly in the complex with LRP6. Moderately expressed in placenta and at low levels in adult lung, spleen, and prostate. Belongs to the Wnt family. Protein type: Secreted; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 1q42. Cellular Component: extracellular space; proteinaceous extracellular matrix; cell surface; Golgi lumen; early endosome membrane; endoplasmic reticulum lumen; extracellular region; plasma membrane. Molecular Function: protein domain specific binding; protein binding; frizzled binding; transcription coactivator activity; receptor agonist activity; frizzled-2 binding. Biological Process: positive regulation of mesodermal cell fate specification; axon guidance; extracellular matrix organization and biogenesis; positive regulation of protein binding; cell proliferation in forebrain; positive regulation of transcription, DNA-dependent; positive regulation of receptor internalization; positive regulation of caspase activity; Wnt receptor signaling pathway through beta-catenin; positive regulation of collateral sprouting in the absence of injury; palate development; negative regulation of axon extension involved in axon guidance; Wnt receptor signaling pathway in forebrain neuroblast division; negative regulation of neurogenesis; neuron differentiation; mammary gland development; positive regulation of cell proliferation; positive regulation of B cell proliferation; hemopoiesis; heart looping; dorsoventral neural tube patterning; inner ear morphogenesis; in utero embryonic development; hippocampus development; negative regulation of fat cell differentiation; positive regulation of peptidyl-serine phosphorylation; osteoblast differentiation; paraxial mesodermal cell fate commitment; signalosome assembly; spinal cord association neuron differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; positive regulation of protein amino acid phosphorylation

size1 :

0.01 mg

price1 :

180 USD

size2 :

0.1 mg

price2 :

315

more info or order :

MyBioSource product webpage