catalog number :
MBS718871
products type :
Recombinant Protein
products full name :
Recombinant Human Myosin-9 (MYH9), partial
products short name :
Myosin-9 (MYH9), partial
products name syn :
Myosin-9; Cellular myosin heavy chain, type A; Myosin heavy chain 9; Myosin heavy chain, non-muscle IIa; Non-muscle myosin heavy chain A; NMMHC-A; Non-muscle myosin heavy chain IIa; NMMHC II-a; NMMHC-IIA
other names :
myosin-9; Myosin-9; myosin-9; non-muscle myosin heavy chain A; non-muscle myosin heavy chain IIa; nonmuscle myosin heavy chain II-A; cellular myosin heavy chain, type A; non-muscle myosin heavy polypeptide 9; myosin, heavy chain 9, non-muscle; Cellular myosin heavy chain, type A; Myosin heavy chain 9; Myosin heavy chain, non-muscle IIa; Non-muscle myosin heavy chain A; NMMHC-A; Non-muscle myosin heavy chain IIa; NMMHC II-a; NMMHC-IIA
products gene name :
MYH9
other gene names :
MYH9; MYH9; MHA; FTNS; EPSTS; BDPLT6; DFNA17; NMMHCA; NMHC-II-A; NMMHC-IIA; NMMHC-A; NMMHC II-a; NMMHC-IIA
uniprot entry name :
MYH9_HUMAN
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-241, partial.
sequence :
AQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSG
FEPASLKEEVGEEAIVELVENGKKVKVNKDDIQKMNPPK
FSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFC
VVINPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTA
YRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAYVAS
SHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRF
GKFIRI
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Homo sapiens (Human)
products description :
Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the margins but not the central part of spreading cells), and lamellipodial retraction; this function is mechanically antagonized by MYH10.
ncbi acc num :
NP_002464.1
ncbi gb acc num :
NM_002473.5
ncbi mol weight :
159,864 Da
ncbi pathways :
Axon Guidance Pathway (105688); Developmental Biology Pathway (477129); EPH-Ephrin Signaling Pathway (1016174); EPHA-mediated Growth Cone Collapse Pathway (1016175); Fcgamma Receptor (FCGR) Dependent Phagocytosis Pathway (771577); Immune System Pathway (106386); Innate Immune System Pathway (106387); Regulation Of Actin Cytoskeleton Pathway (83089); Regulation Of Actin Cytoskeleton Pathway (500); Regulation Of Actin Dynamics For Phagocytic Cup Formation Pathway (771579)
ncbi summary :
This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. [provided by RefSeq, Dec 2011]
uniprot summary :
MYH9: Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. Interacts with PDLIM2. Interacts with SLC6A4. Myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Interacts with RASIP1. Interacts with DDR1. Interacts with SVIL and HTRA3. In the kidney, expressed in the glomeruli. Also expressed in leukocytes. 2 isoforms of the human protein are produced by alternative splicing. Protein type: Motor; Actin-binding; Motility/polarity/chemotaxis. Chromosomal Location of Human Ortholog: 22q13.1. Cellular Component: signalosome; cortical cytoskeleton; protein complex; myosin II complex; leading edge; contractile ring; immunological synapse; actomyosin; cytosol; actin cytoskeleton; ruffle; cell-cell adherens junction; membrane; cytoplasm; plasma membrane; stress fiber; spindle; uropod; neuromuscular junction; integrin complex; nucleus; cleavage furrow. Molecular Function: microfilament motor activity; calmodulin binding; actin filament binding; protein binding; protein homodimerization activity; protein anchor; ATPase activity; motor activity; ADP binding; actin-dependent ATPase activity; actin binding; ATP binding. Biological Process: integrin-mediated signaling pathway; axon guidance; monocyte differentiation; blood vessel endothelial cell migration; in utero embryonic development; actin filament-based movement; membrane protein ectodomain proteolysis; actomyosin structure organization and biogenesis; cytokinesis; uropod organization and biogenesis; regulation of cell shape; establishment of meiotic spindle localization; protein transport; actin cytoskeleton reorganization; ephrin receptor signaling pathway; establishment of T cell polarity; angiogenesis; platelet formation; leukocyte migration; myoblast fusion; meiotic spindle organization and biogenesis. Disease: Deafness, Autosomal Dominant 17; May-hegglin Anomaly; Fechtner Syndrome; Macrothrombocytopenia And Progressive Sensorineural Deafness; Epstein Syndrome; Sebastian Syndrome
size4 :
0.05 mg (Baculovirus)