product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Cytochrome c (CYCS)
catalog :
MBS718743
quantity :
1 mg (E-Coli)
price :
1155 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS718743
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Cytochrome c (CYCS)
products short name :
(Rhesus macaque) Cytochrome c (CYCS)
products name syn :
Recombinant (Rhesus macaque) Cytochrome c (CYCS); Cytochrome c
other names :
PREDICTED: cytochrome c-like; Cytochrome c; cytochrome c, somatic
products gene name syn :
CYCS; CYC
other gene names :
CYCS; CYCS; CYC
uniprot entry name :
CYC_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
2-105
sequence length :
105
sequence :
GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRK
TGQAPGYSYTAANKNKGITWGEDTLMEYLENPKKYIPGT
KMIFVGIKKKEERADLIAYLKKATNE
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
297288680
ncbi acc num :
XP_002803395.1
ncbi gb acc num :
XM_002803349.1
uniprot acc num :
P00002
ncbi mol weight :
11,737 Da
ncbi pathways :
Alzheimer's Disease Pathway (86767); Alzheimer's Disease Pathway (509); Amyotrophic Lateral Sclerosis (ALS) Pathway (86769); Amyotrophic Lateral Sclerosis (ALS) Pathway (511); Apoptosis Pathway (86730); Apoptosis Pathway (470); Colorectal Cancer Pathway (86772); Colorectal Cancer Pathway (518); Herpes Simplex Infection Pathway (377876); Herpes Simplex Infection Pathway (377865)
uniprot summary :
Function: Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases . By similarity. Subcellular location: Mitochondrion intermembrane space. Note: Loosely associated with the inner membrane. Post-translational modification: Binds 1 heme group per subunit.Phosphorylation at Tyr-49 and Tyr-98 both reduce by half the turnover in the reaction with cytochrome c oxidase, down-regulating mitochondrial respiration . By similarity. Sequence similarities: Belongs to the cytochrome c family.
size1 :
1 mg (E-Coli)
price1 :
1155 USD
size2 :
1 mg (Yeast)
price2 :
1615
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!