protein

Recombinant Human Keratin, type I cytoskeletal 10

MBS718741

0.05 mg (E-Coli)

185 USD

Recombinant Protein

Recombinant Human Keratin, type I cytoskeletal 10

Keratin, type I cytoskeletal 10

Cytokeratin-10; CK-10; Keratin-10; K10

keratin, type I cytoskeletal 10; Keratin, type I cytoskeletal 10; keratin, type I cytoskeletal 10; keratin 10, type I; Cytokeratin-10; CK-10; Keratin-10; K10

KRT10

KRT10; KRT10; BIE; EHK; K10; KPP; BCIE; CK10; KPP; CK-10; K10

K1C10_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-584

584

MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSS
KGSLGGGFSSGGFSGGSFSRGSSGGGCFGGSSGGYGGLG
GFGGGSFRGSYGSSSFGGSYGGSFGGGSFGGGSFGGGSF
GGGGFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDR
LASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD
YSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDF
RLKYENEVALRQSVEADINGL

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Signal Transduction

The complete sequence of the human intermediate filament chain keratin 10. Subdomainal divisions and model for folding of end domain sequences.Zhou X.M., Idler W.W., Steven A.C., Roop D.R., Steinert P.M.J. Biol. Chem. 263:15584-15589(1988) Identification of an orthologous mammalian cytokeratin gene. High degree of intron sequence conservation during evolution of human cytokeratin 10.Rieger M., Franke W.W.J. Mol. Biol. 204:841-856(1988) DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.Nature 440:1045-1049(2006) Sequence of a cDNA encoding human keratin No 10 selected according to structural homologies of keratins and their tissue-specific expression.Darmon M.Y., Semat A., Darmon M.C., Vasseur M.Mol. Biol. Rep. 12:277-283(1987) Prenatal diagnosis of epidermolytic hyperkeratosis by direct gene sequencing.Rothnagel J.A., Longley M.A., Holder R.A., Kuster W., Roop D.R.J. Invest. Dermatol. 102:13-16(1994) Identification of mutational hot spots in the suprabasal keratin genes from patients with epidermolytic hyperkeratosis.Rothnagel J.J., Dominey A., Fisher M., Axtell S., Pittelkow M., Anton-Lamprecht I., Hohl D., Roop D.Exons I and VII of the gene (Ker10) encoding human keratin 10 undergo structural rearrangements within repeats.Tkachenko A.V., Buchman V.L., Bliskovsky V.V., Shvets Y.P., Kisselev L.L.Gene 116:245-251(1992) Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.Rasmussen H.H., van Damme J., Puype M., Gesser B., Celis J.E., Vandekerckhove J.Electrophoresis 13:960-969(1992) Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.Mol. Cell 31:438-448(2008) Mitotic recombination in patients with ichthyosis causes reversion of dominant mutations in KRT10.Choate K.A., Lu Y., Zhou J., Choi M., Elias P.M., Farhi A., Nelson-Williams C., Crumrine D., Williams M.L., Nopper A.J., Bree A., Milstone L.M., Lifton R.P.Science 330:94-97(2010) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) The genetic basis of epidermolytic hyperkeratosis a disorder of differentiation-specific epidermal keratin genes.Cheng J., Syder A.J., Yu Q.-C., Letai A., Paller A.S., Fuchs E.Cell 70:811-819(1992) Extensive size polymorphism of the human keratin 10 chain resides in the C-terminal V2 subdomain due to variable numbers and sizes of glycine loops.Korge B.P., Gan S.-Q., McBridge O.W., Mischke D., Steinert P.M.Proc. Natl. Acad. Sci. U.S.A. 89:910-914(1992) Mutations in the rod domains of keratins 1 and 10 in epidermolytic hyperkeratosis.Rothnagel J.A., Dominey A.M., Dempsey L.D., Longley M.A., Greenhalgh D.A., Gagne T.A., Huber M., Frenk E., Hohl D., Roop D.R.Science 257:1128-1130(1992) Preferential sites in keratin 10 that are mutated in epidermolytic hyperkeratosis.Chipev C.C., Yang J.-M., Digiovanna J.J., Steinert P.M., Marekov L., Compton J.G., Bale S.J.Am. J. Hum. Genet. 54:179-190(1994) Genetic mutations in the K1 and K10 genes of patients with epidermolytic hyperkeratosis. Correlation between location and disease severity.Syder A.J., Yu Q.-C., Paller A.S., Giudice G., Pearson R., Fuchs E.J. Clin. Invest. 93:1533-1542(1994) Mutations in the rod 1A domain of keratins 1 and 10 in bullous congenital ichthyosiform erythroderma (BCIE) .McLean W.H.I., Eady R.A.J., Dopping-Hepenstal P.J.C., McMillan J.R., Leigh I.M., Navsaria H.A., Higgins C., Harper J.I., Paige D.G., Morley S.M.J. Invest. Dermatol. 102:24-30(1994) Genetic and clinical mosaicism in a type of epidermal nevus.Paller A.S., Syder A.J., Chan Y.-M., Yu Q.-C., Hutton M.E., Tadini G., Fuchs E.N. Engl. J. Med. 331:1408-1415(1994) A novel dinucleotide mutation in keratin 10 in the annular epidermolytic ichthyosis variant of bullous congenital ichthyosiform erythroderma.Joh G.-Y., Traupe H., Metze D., Nashan D., Huber M., Hohl D., Longley M.A., Rothnagel J.A., Roop D.R.J. Invest. Dermatol. 108:357-361(1997) A novel helix termination mutation in keratin 10 in annular epidermolytic ichthyosis, a variant of bullous congenital ichthyosiform erythroderma.Suga Y., Duncan K.O., Heald P.W., Roop D.R.J. Invest. Dermatol. 111:1220-1223(1998) A novel substitution in keratin 10 in epidermolytic hyperkeratosis.Arin M.J., Longley M.A., Anton-Lamprecht I., Kurze G., Huber M., Hohl D., Rothnagel J.A., Roop D.R.J. Invest. Dermatol. 112:506-508(1999) Expanding the keratin mutation database novel and recurrent mutations and genotype-phenotype correlations in 28 patients with epidermolytic ichthyosis.Arin M.J., Oji V., Emmert S., Hausser I., Traupe H., Krieg T., Grimberg G.Br. J. Dermatol. 164:442-447(2011)

195972866

NP_000412.3

NM_000421.3

P13645

62.9kD

Staphylococcus Aureus Infection Pathway (172846); Staphylococcus Aureus Infection Pathway (171867)

This gene encodes a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in this gene are associated with epidermolytic hyperkeratosis. This gene is located within a cluster of keratin family members on chromosome 17q21. [provided by RefSeq, Jul 2008]

K10: a type I cytoskeletal keratin. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. There are two types of cytoskeletal and microfibrillar keratin: type I (acidic; 40-55 kDa) [K9 to K20] and type II (neutral to basic; 56-70 kDa) [K1 to K8]. Both a basic and an acidic keratin are required for filament assembly. Generally associates with K1. Protein type: Cytoskeletal. Chromosomal Location of Human Ortholog: 17q21. Cellular Component: cytoplasm; extracellular space; intermediate filament; keratin filament; membrane; nucleus. Molecular Function: structural constituent of epidermis. Biological Process: keratinocyte differentiation. Disease: Epidermolytic Hyperkeratosis; Erythroderma, Ichthyosiform, Congenital Reticular; Ichthyosis, Cyclic, With Epidermolytic Hyperkeratosis

0.05 mg (E-Coli)

185 USD

0.2 mg (E-Coli)

420

0.5 mg (E-Coli)

680

1 mg (E-Coli)

1070