protein

Recombinant Human Vitamin K-dependent protein S

MBS718708

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Vitamin K-dependent protein S

Vitamin K-dependent protein S

vitamin K-dependent protein S isoform 2 preproprotein; Vitamin K-dependent protein S; vitamin K-dependent protein S; protein S (alpha)

PROS1

PROS1; PROS1; PSA; PROS; PS21; PS22; PS23; PS24; PS25; THPH5; THPH6; PROS

PROS_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

42-676

676

ANSLLEETKQGNLERECIEELCNKEEAREVFENDPETDY
FYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPD
QCSPLPCNEDGYMSCKDGKASFTCTCKPGWQGEKCEFDI
NECKDPSNINGGCSQICDNTPGSYHCSCKNGFVMLSNKK
DCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNL
KSKSCEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKL
AQDQKSCEVVSVCLPLNLDTK

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cardiovascular

Anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis.

Human protein S cDNA encodes Phe-16 and Tyr 222 in consensus sequences for the post-translational processing.Ploos van Amstel H.K., van der Zanden A.L., Reitsma P.H., Bertina R.M.FEBS Lett. 222:186-190(1987) Cloning and characterization of human liver cDNA encoding a protein S precursor.Hoskins J., Norman D.K., Beckmann R.J., Long G.L.Proc. Natl. Acad. Sci. U.S.A. 84:349-353(1987) Organization of the human protein S genes.Schmidel D.K., Tatro A.V., Phelps L.G., Tomczak J.A., Long G.L.Biochemistry 29:7845-7852(1990) Intron-exon organization of the active human protein S gene PS alpha and its pseudogene PS beta duplication and silencing during primate evolution.Ploos van Amstel H.K., Reitsma P.H., der Logt C.P., Bertina R.M.Biochemistry 29:7853-7861(1990) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) SeattleSNPs variation discovery resource

192447438

NP_000304.2

NM_000313.3

P07225

86.6kD

Cell Surface Interactions At The Vascular Wall Pathway (1269373); Common Pathway Of Fibrin Clot Formation (1269371); Complement And Coagulation Cascades Pathway (198880); Complement And Coagulation Cascades Pathway (83073); Complement And Coagulation Cascades Pathway (484); Complement Cascade Pathway (1269241); Formation Of Fibrin Clot (Clotting Cascade) Pathway (1269368); Gamma Carboxylation, Hypusine Formation And Arylsulfatase Activation Pathway (1268702); Gamma-carboxylation Of Protein Precursors Pathway (1268704); Gamma-carboxylation, Transport, And Amino-terminal Cleavage Of Proteins Pathway (1268703)

This gene encodes a vitamin K-dependent plasma protein that functions as a cofactor for the anticoagulant protease, activated protein C (APC) to inhibit blood coagulation. It is found in plasma in both a free, functionally active form and also in an inactive form complexed with C4b-binding protein. Mutations in this gene result in autosomal dominant hereditary thrombophilia. An inactive pseudogene of this locus is located at an adjacent region on chromosome 3. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Oct 2015]

PROS1: Anticoagulant plasma protein; it is a cofactor to activated protein C in the degradation of coagulation factors Va and VIIIa. It helps to prevent coagulation and stimulating fibrinolysis. Defects in PROS1 are the cause of thrombophilia due to protein S deficiency, autosomal dominant (THPH5). A hemostatic disorder characterized by impaired regulation of blood coagulation and a tendency to recurrent venous thrombosis. However, many adults with heterozygous disease may be asymptomatic. Based on the plasma levels of total and free PROS1 antigen as well as the serine protease-activated protein C cofactor activity, three types of PROS1D have been described: type I, characterized by reduced total and free PROS1 antigen levels together with reduced anticoagulant activity; type III, in which only free PROS1 antigen and PROS1 activity levels are reduced; and the rare type II which is characterized by normal concentrations of both total and free PROS1 antigen, but low cofactor activity. Defects in PROS1 are the cause of thrombophilia due to protein S deficiency, autosomal recessive (THPH6). A very rare and severe hematologic disorder resulting in thrombosis and secondary hemorrhage usually beginning in early infancy. Some affected individuals develop neonatal purpura fulminans, multifocal thrombosis, or intracranial hemorrhage. Protein type: Secreted, signal peptide; Secreted. Chromosomal Location of Human Ortholog: 3q11.2. Cellular Component: endoplasmic reticulum membrane; extracellular region; extracellular space; Golgi lumen; Golgi membrane; plasma membrane; protein complex. Molecular Function: calcium ion binding; endopeptidase inhibitor activity; protein complex binding. Biological Process: blood coagulation; cellular protein metabolic process; ER to Golgi vesicle-mediated transport; fibrinolysis; innate immune response; leukocyte migration; peptidyl-glutamic acid carboxylation; platelet activation; platelet degranulation; positive regulation of phagocytosis; post-translational protein modification; regulation of complement activation; response to lipopolysaccharide; signal peptide processing. Disease: Thrombophilia Due To Protein S Deficiency, Autosomal Dominant; Thrombophilia Due To Protein S Deficiency, Autosomal Recessive

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180

0.05 mg (Baculovirus)

1430