protein

Recombinant Mouse Myc proto-oncogene protein

MBS718639

0.05 mg (E-Coli)

175 USD

Recombinant Protein

Recombinant Mouse Myc proto-oncogene protein

Myc proto-oncogene protein

Proto-oncogene c-Myc; Transcription factor p64

myc proto-oncogene protein isoform b; Myc proto-oncogene protein; myc proto-oncogene protein; myelocytomatosis oncogene; Proto-oncogene c-Myc; Transcription factor p64

Myc

Myc; Myc; Myc2; Nird; Niard; bHLHe39; AU016757

MYC_MOUSE

E Coli or Yeast or Baculovirus or Mammalian Cell

1-439, Full length.

439

MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSE
LQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVA
TSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFI
CDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAA
RKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVV
FPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRAS
PEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTP
AKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAP
PSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTE
ENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKA
PKVVILKKATAYILSIQADEHKLTSEKDLLRKRREQLKH
KLEQLRNSGA

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes.

Sequence of the murine and human cellular myc oncogenes and two modes of myc transcription resulting from chromosome translocation in B lymphoid tumours.Bernard O., Cory S., Gerondakis S., Webb E., Adams J.M.EMBO J. 2:2375-2383(1983) Nucleotide sequence comparison of normal and translocated murine c-myc genes.Stanton L.W., Fahrlander P.D., Tesser P.M., Marcu K.B.Nature 310:423-425(1984) Reciprocal chromosome translocation between c-myc and immunoglobulin gamma 2b genes.Neuberger M.S., Calabi F.Nature 305:240-243(1983) Mad3 and Mad4 novel Max-interacting transcriptional repressors that suppress c-myc dependent transformation and are expressed during neural and epidermal differentiation.Hurlin P.J., Queva C., Koskinen P.J., Steingrimsson E., Ayer D.E., Copeland N.G., Jenkins N.A., Eisenman R.N.EMBO J. 14:5646-5659(1995) ErratumHurlin P.J., Queva C., Koskinen P.J., Steingrimsson E., Ayer D.E., Copeland N.G., Jenkins N.A., Eisenman R.N.EMBO J. 15:2030-2030(1996) JLP a scaffolding protein that tethers JNK/p38MAPK signaling modules and transcription factors.Lee C.M., Onesime D., Reddy C.D., Dhanasekaran N., Reddy E.P.Proc. Natl. Acad. Sci. U.S.A. 99:14189-14194(2002) Induction of pluripotent stem cells from mouse embryonic and adult fibroblast cultures by defined factors.Takahashi K., Yamanaka S.Cell 126:663-676(2006) Pim kinase-dependent inhibition of c-Myc degradation.Zhang Y., Wang Z., Li X., Magnuson N.S.Oncogene 27:4809-4819(2008) SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013)

293629264

NP_001170823.1

NM_001177352.1

P01108

75.6kD

Acute Myeloid Leukemia Pathway (83310); Acute Myeloid Leukemia Pathway (529); Apoptosis Pathway (198339); Bladder Cancer Pathway (83308); Bladder Cancer Pathway (527); Cell Cycle Pathway (83251); Cell Cycle Pathway (463); Cell Cycle Signaling Pathway (522974); Central Carbon Metabolism In Cancer Pathway (1060315); Central Carbon Metabolism In Cancer Pathway (1084231)

The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma, in human. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini, in human and mouse. Under conditions of stress, such as high cell densities and methionine deprivation, there is a specific and dramatic increase in the synthesis of the non-AUG initiated protein, suggesting its importance in times of adversity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]

Myc: a proto-oncogenic transcription factor that plays a role in cell proliferation, apoptosis and in the development of human tumors. Seems to activate the transcription of growth-related genes. Protein type: DNA-binding; Transcription factor; Nucleolus; Oncoprotein. Cellular Component: axon; cytoplasm; mitochondrion; nuclear body; nucleolus; nucleoplasm; nucleus; perinuclear region of cytoplasm; protein complex; spindle. Molecular Function: DNA binding; double-stranded DNA binding; protein binding; protein complex binding; protein dimerization activity; protein heterodimerization activity; sequence-specific DNA binding; transcription factor activity; transcription factor binding; ubiquitin protein ligase binding. Biological Process: amino acid transport; B cell apoptosis; caspase activation; cell cycle arrest; cell proliferation; cellular iron ion homeostasis; chromatin remodeling; chromosome organization and biogenesis; detection of mechanical stimulus involved in sensory perception of sound; DNA damage response, signal transduction resulting in induction of apoptosis; glucose metabolic process; inner mitochondrial membrane organization and biogenesis; lactic acid secretion; MAPKKK cascade; middle ear morphogenesis; negative regulation of cell division; negative regulation of fibroblast proliferation; negative regulation of glucose import; negative regulation of monocyte differentiation; negative regulation of protein binding; negative regulation of transcription from RNA polymerase II promoter; pigmentation; positive regulation of B cell apoptosis; positive regulation of caspase activity; positive regulation of catalytic activity; positive regulation of cell cycle; positive regulation of cell proliferation; positive regulation of DNA binding; positive regulation of epithelial cell proliferation; positive regulation of fibroblast proliferation; positive regulation of glycolysis; positive regulation of mesenchymal cell proliferation; positive regulation of smooth muscle cell migration; positive regulation of smooth muscle cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; protein processing; pyruvate transport; re-entry into mitotic cell cycle; regulation of apoptosis; regulation of gene expression; regulation of mitotic cell cycle; regulation of oxidative phosphorylation; regulation of telomere maintenance; regulation of transcription, DNA-dependent; response to alkaloid; response to DNA damage stimulus; response to gamma radiation; response to radiation; skeletal morphogenesis; transcription from RNA polymerase II promoter; transcription initiation; transcription, DNA-dependent; transformation of host cell by virus; ureteric bud branching; Wnt receptor signaling pathway; Wnt receptor signaling pathway through beta-catenin

0.05 mg (E-Coli)

175 USD

0.2 mg (E-Coli)

295

0.5 mg (E-Coli)

580

1 mg (E-Coli)

855

0.05 mg (Baculovirus)

950