protein

Recombinant Human Insulin-like growth factor-binding protein 3

MBS718617

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Insulin-like growth factor-binding protein 3

Insulin-like growth factor-binding protein 3

insulin-like growth factor-binding protein 3 isoform b; Insulin-like growth factor-binding protein 3; insulin-like growth factor-binding protein 3; insulin like growth factor binding protein 3

IGFBP3

IGFBP3; IGFBP3; IBP3; BP-53; IBP3; IBP-3; IGF-binding protein 3; IGFBP-3

IBP3_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

28-291

291

GASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPG
CGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQ
ALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDR
SAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDS
QRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLN
HLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGF
CWCVDKYGQPLPGYTTKGKED

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Signal Transduction

IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TM219/IGFBP-3R.

Cloning and expression of the growth hormone-dependent insulin-like growth factor-binding protein.Wood W.I., Cachianes G., Henzel W.J., Winslow G.A., Spencer S.A., Hellmiss R., Martin J.L., Baxter R.C.Mol. Endocrinol. 2:1176-1185(1988) Insulin-like growth factor binding protein-3. Organization of the human chromosomal gene and demonstration of promoter activity.Cubbage M.L., Suwanichkul A., Powell D.R.J. Biol. Chem. 265:12642-12649(1990) Analysis of the primary structure of insulin-like growth factor binding protein-3 cDNA from Werner syndrome fibroblasts.Thweatt R., Fleischmann R., Goldstein S.DNA Seq. 4:43-46(1993) NIEHS SNPs programThe DNA sequence of human chromosome 7.Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.Nature 424:157-164(2003) Human chromosome 7 DNA sequence and biology.Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S., Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.Science 300:767-772(2003)

62243068

NP_000589.2

NM_000598.4

P17936

44.7kD

Direct P53 Effectors Pathway (137939); Integrated Pancreatic Cancer Pathway (711360); Metabolism Of Proteins Pathway (1268677); Myometrial Relaxation And Contraction Pathways (198759); Regulation Of Insulin-like Growth Factor (IGF) Transport And Uptake By Insulin-like Growth Factor Binding Proteins (IGFBPs) Pathway (1268755); Senescence And Autophagy Pathway (198780); Transcriptional Misregulation In Cancer Pathway (523016); Transcriptional Misregulation In Cancer Pathway (522987); P53 Signaling Pathway (83055); P53 Signaling Pathway (465)

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

IGFBP3: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TMEM219/IGFBP-3R. Protein type: Secreted; Cell development/differentiation; Secreted, signal peptide. Chromosomal Location of Human Ortholog: 7p12.3. Cellular Component: extracellular region; extracellular space; insulin-like growth factor binding protein complex; nucleus. Molecular Function: fibronectin binding; insulin-like growth factor binding; insulin-like growth factor I binding; insulin-like growth factor II binding; metal ion binding; protein binding; protein tyrosine phosphatase activator activity. Biological Process: apoptosis; cellular protein metabolic process; negative regulation of cell proliferation; negative regulation of protein amino acid phosphorylation; negative regulation of signal transduction; negative regulation of smooth muscle cell migration; negative regulation of smooth muscle cell proliferation; osteoblast differentiation; positive regulation of apoptosis; positive regulation of catalytic activity; positive regulation of insulin-like growth factor receptor signaling pathway; positive regulation of MAPKKK cascade; positive regulation of myoblast differentiation; protein amino acid phosphorylation; regulation of cell growth; regulation of insulin-like growth factor receptor signaling pathway

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750