product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse 78 kDa glucose-regulated protein (Hspa5)
catalog :
MBS718537
quantity :
0.05 mg (Yeast)
price :
167 USD
more info or order :
product information
catalog number :
MBS718537
products type :
Recombinant Protein
products full name :
Recombinant Mouse 78 kDa glucose-regulated protein (Hspa5)
products short name :
78 kDa glucose-regulated protein (Hspa5)
products name syn :
78 kDa glucose-regulated protein; GRP-78; Heat shock 70 kDa protein 5; Immunoglobulin heavy chain-binding protein; BiP
other names :
78 kDa glucose-regulated protein; 78 kDa glucose-regulated protein; 78 kDa glucose-regulated protein; GRP-78; XAP-1 antigen; heat shock 70 kDa protein 5; glucose regulated protein, 78 kDa; immunoglobulin heavy chain-binding protein; heat shock 70kD protein 5 (glucose-regulated protein, 78kD); heat shock protein 5; Heat shock 70 kDa protein 5; Immunoglobulin heavy chain-binding protein; BiP
products gene name :
Hspa5
products gene name syn :
Hspa5; Grp78
other gene names :
Hspa5; Hspa5; Bip; Sez7; mBiP; Grp78; SEZ-7; Hsce70; baffled; AL022860; AU019543; D2Wsu17e; D2Wsu141e; Grp78; GRP-78; BiP
uniprot entry name :
GRP78_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
20-655; Mature full length protein;
sequence length :
655
sequence :
EEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQ
GNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAK
RLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGG
QTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPA
YFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDK
REGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTH
LGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRRE
VEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEEL
NMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIP
KIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGD
QDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKK
SQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTG
IPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKIT
ITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNE
LESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIE
WLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGGPPP
TGEEDTSEKDEL
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
other info1 :
Species: Mus musculus (Mouse)
products description :
Probably plays a role in facilitating the assembly of multimeric protein complexes inside the endoplasmic reticulum. Involved in the correct folding of proteins and degradation of misfolded proteins via its interaction with DNAJC10, probably to facilitate the release of DNAJC10 from its substrate (By similarity).
ncbi gi num :
254540168
ncbi acc num :
NP_001156906.1
ncbi gb acc num :
NM_001163434.1
uniprot acc num :
P20029
ncbi mol weight :
74kD
ncbi pathways :
ATF6-alpha Activates Chaperone Genes Pathway (1000425); ATF6-alpha Activates Chaperones Pathway (1000424); Antigen Processing And Presentation Pathway (83271); Antigen Processing And Presentation Pathway (485); Hemostasis Pathway (1001295); MAPK Signaling Pathway (198294); Metabolism Of Proteins Pathway (970583); Platelet Activation, Signaling And Aggregation Pathway (1001305); Platelet Degranulation Pathway (1001317); Prion Diseases Pathway (101157)
uniprot summary :
GRP78: a member of the HSP family of molecular chaperones required for endoplasmic reticulum integrity and stress-induced autophagy. Plays a central role in regulating the unfolded protein response (UPR), and is an obligatory component of autophagy in mammalian cells. May play an important role in cellular adaptation and oncogenic survival. One of the client proteins of GRP78 is protein double-stranded RNA-activated protein-like endoplasmic reticulum kinase (PERK). Probably plays a role in facilitating the assembly of multimeric protein complexes inside the ER. Protein type: Heat shock protein; Chaperone. Cellular Component: signalosome; endoplasmic reticulum membrane; smooth endoplasmic reticulum; cell surface; focal adhesion; mitochondrion; endoplasmic reticulum; endoplasmic reticulum lumen; ER-Golgi intermediate compartment; membrane; cytoplasm; plasma membrane; integral to endoplasmic reticulum membrane; midbody; nucleus; myelin sheath. Molecular Function: protein domain specific binding; protein binding; enzyme binding; ubiquitin protein ligase binding; unfolded protein binding; nucleotide binding; ribosome binding; misfolded protein binding; glycoprotein binding; ATP binding. Biological Process: cellular response to glucose starvation; positive regulation of embryonic development; unfolded protein response, activation of signaling protein activity; cerebellum structural organization; proteolysis involved in cellular protein catabolic process; positive regulation of protein ubiquitination; cerebellar Purkinje cell layer development; negative regulation of transforming growth factor beta receptor signaling pathway; ER overload response; negative regulation of apoptosis; positive regulation of cell migration
size1 :
0.05 mg (Yeast)
price1 :
167 USD
size2 :
0.05 mg (E-Coli)
price2 :
305
size3 :
0.2 mg (E-Coli)
price3 :
580
size4 :
0.2 mg (Yeast)
price4 :
835
size5 :
0.05 mg (Baculovirus)
price5 :
950
more info or order :
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!