protein

Recombinant Human Transcriptional enhancer factor TEF-1

MBS718469

0.05 mg (E-Coli)

180 USD

Recombinant Protein

Recombinant Human Transcriptional enhancer factor TEF-1

Transcriptional enhancer factor TEF-1

NTEF-1; Protein GT-IIC; TEA domain family member 1; TEAD-1; Transcription factor 13; TCF-13

transcriptional enhancer factor TEF-1; Transcriptional enhancer factor TEF-1; transcriptional enhancer factor TEF-1; TEA domain transcription factor 1; NTEF-1; Protein GT-IIC; TEA domain family member 1; TEAD-1; Transcription factor 13; TCF-13

TEAD1

TEAD1; TEAD1; AA; REF1; TCF13; TEF-1; NTEF-1; TCF-13; TEAD-1; TCF13; TEF1; TEAD-1; TCF-13

TEAD1_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-426; Full length

426

MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDI
EQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIK
LRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKDQTAKDK
ALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTFPGAPGF
WPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEP
ASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSY
NKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGL
KELFGKGPQNAFFLVKFWADLNCNIQDDAGAFYGVTSQY
ESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFVY
RINRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILLV
VTNRDTQETLLCMACVFEVSNSEHGAQHHIYRLVKD

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cardiovascular

Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (T) induction. Binds specifically and cooperatively to the SPH and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription in vivo in a cell-specific manner. The activation function appears to be mediated by a limiting cell-specific transcriptional intermediary factor (TIF). Involved in cardiac development. Binds to the M-CAT motif.

Cloning, expression, and transcriptional properties of the human enhancer factor TEF-1.Xiao J.H., Davidson I., Matthes H., Garnier J.-M., Chambon P.Cell 65:551-568(1991) Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006) The TEA domain a novel, highly conserved DNA-binding motif.Buerglin T.R.Cell 66:11-12(1991) TEAD mediates YAP-dependent gene induction and growth control.Zhao B., Ye X., Yu J., Li L., Li W., Li S., Yu J., Lin J.D., Wang C.Y., Chinnaiyan A.M., Lai Z.C., Guan K.L.Genes Dev. 22:1962-1971(2008) TEAD transcription factors mediate the function of TAZ in cell growth and epithelial-mesenchymal transition.Zhang H., Liu C.Y., Zha Z.Y., Zhao B., Yao J., Zhao S., Xiong Y., Lei Q.Y., Guan K.L.J. Biol. Chem. 284:13355-13362(2009) Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.Sci. Signal. 3:RA3-RA3(2010) System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.Sci. Signal. 4:RS3-RS3(2011) Insights into transcription enhancer factor 1 (TEF-1) activity from the solution structure of the TEA domain.Anbanandam A., Albarado D.C., Nguyen C.T., Halder G., Gao X., Veeraraghavan S.Proc. Natl. Acad. Sci. U.S.A. 103:17225-17230(2006) Structural insights into the YAP and TEAD complex.Li Z., Zhao B., Wang P., Chen F., Dong Z., Yang H., Guan K.L., Xu Y.Genes Dev. 24:235-240(2010) A novel TEAD1 mutation is the causative allele in Sveinsson's chorioretinal atrophy (helicoid peripapillary chorioretinal degeneration) .Fossdal R., Jonasson F., Kristjansdottir G.T., Kong A., Stefansson H., Gosh S., Gulcher J.R., Stefansson K.Hum. Mol. Genet. 13:975-981(2004)

296434319

NP_068780.2

NM_021961.5

P28347

49.95kD

Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway (1270010); Gene Expression Pathway (1269649); Generic Transcription Pathway (1269650); Hippo Signaling Pathway (1084759); Hippo Signaling Pathway (1108222); Hippo Signaling Pathway (749777); Hippo Signaling Pathway (750388); Metabolism Pathway (1269956); Metabolism Of Lipids And Lipoproteins Pathway (1270001); PPARA Activates Gene Expression Pathway (1270030)

This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified. [provided by RefSeq, May 2010]

TEAD1: Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and cooperatively to the SPH and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription in vivo in a cell-specific manner. The activation function appears to be mediated by a limiting cell-specific transcriptional intermediary factor (TIF). Involved in cardiac development. Binds to the M-CAT motif. Interacts with YAP1 and WWTR1/TAZ. Preferentially expressed in skeletal muscle. Lower levels in pancreas, placenta, and heart. Protein type: Transcription factor; DNA-binding. Chromosomal Location of Human Ortholog: 11p15.2. Cellular Component: nucleoplasm. Molecular Function: DNA binding; protein binding; transcription factor activity. Biological Process: gene expression; regulation of transcription, DNA-dependent; transcription initiation from RNA polymerase II promoter. Disease: Sveinsson Chorioretinal Atrophy

0.05 mg (E-Coli)

180 USD

0.05 mg (Yeast)

190

0.2 mg (Yeast)

460

0.2 mg (E-Coli)

490

0.5 mg (E-Coli)

715