Recombinant Human Type-2 angiotensin II receptor | MyBioSource MBS718428 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Type-2 angiotensin II receptor

catalog :

MBS718428

quantity :

0.01 mg (E-Coli)

price :

115 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS718428

products type :

Recombinant Protein

products full name :

Recombinant Human Type-2 angiotensin II receptor

products short name :

Type-2 angiotensin II receptor

products name syn :

Angiotensin II type-2 receptor; AT2

other names :

type-2 angiotensin II receptor; Type-2 angiotensin II receptor; type-2 angiotensin II receptor; angiotensin II receptor type 2; Angiotensin II type-2 receptor; AT2

products gene name :

AGTR2

other gene names :

AGTR2; AGTR2; AT2; ATGR2; MRX88; AT2

uniprot entry name :

AGTR2_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

Jan-45

sequence length :

363

sequence :

MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKP
SDKHLD

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

other info2 :

Species: Homo sapiens (Human)

products categories :

Cardiovascular

products description :

Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation.

products references :

Assignment of the human angiotensin II type 2 receptor gene (AGTR2) to chromosome Xq22-q23 by fluorescence in situ hybridization." Chassagne C., Beatty B.G., Meloche S. Genomics 25:601-603(1995)

ncbi gi num :

23238240

ncbi acc num :

NP_000677.2

ncbi gb acc num :

NM_000686.4

uniprot acc num :

P50052

ncbi mol weight :

20.76kD

ncbi pathways :

ACE Inhibitor Pathway (198763); Adrenergic Signaling In Cardiomyocytes Pathway (908257); Adrenergic Signaling In Cardiomyocytes Pathway (909696); Class A/1 (Rhodopsin-like Receptors) Pathway (1269545); G Alpha (i) Signalling Events Pathway (1269576); GPCR Downstream Signaling Pathway (1269574); GPCR Ligand Binding Pathway (1269544); GPCRs, Class A Rhodopsin-like Pathway (198886); Neuroactive Ligand-receptor Interaction Pathway (83053); Neuroactive Ligand-receptor Interaction Pathway (462)

ncbi summary :

The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation. [provided by RefSeq, Jan 2010]

uniprot summary :

AT2: Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation. Defects in AGTR2 are the cause of mental retardation X- linked type 88 (MRX88). Mental retardation is characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Belongs to the G-protein coupled receptor 1 family. Protein type: Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1. Chromosomal Location of Human Ortholog: Xq22-q23. Cellular Component: extracellular region; integral to plasma membrane; perinuclear region of cytoplasm; plasma membrane. Molecular Function: angiotensin type II receptor activity; peptide hormone binding; protein binding; receptor antagonist activity; transcription factor binding. Biological Process: angiotensin mediated vasodilation involved in regulation of systemic arterial blood pressure; blood vessel remodeling; brain development; brain renin-angiotensin system; cell surface receptor linked signal transduction; cellular sodium ion homeostasis; cerebellar cortex development; dopamine biosynthetic process; G-protein coupled receptor protein signaling pathway; G-protein signaling, coupled to cGMP nucleotide second messenger; inflammatory response; negative regulation of blood vessel endothelial cell migration; negative regulation of cell growth; negative regulation of fibroblast proliferation; negative regulation of heart rate; negative regulation of icosanoid secretion; negative regulation of nerve growth factor receptor signaling pathway; nitric oxide mediated signal transduction; positive regulation of cell proliferation; positive regulation of cytokine secretion; positive regulation of nitric oxide biosynthetic process; positive regulation of nitric-oxide synthase activity; positive regulation of phosphoprotein phosphatase activity; positive regulation of transcription, DNA-dependent; positive regulation of vasodilation; regulation of blood pressure; regulation of systemic arterial blood pressure by circulatory renin-angiotensin; regulation of transcription factor import into nucleus; renin-angiotensin regulation of aldosterone production; response to organic nitrogen

size1 :

0.01 mg (E-Coli)

price1 :

115 USD

size2 :

0.05 mg (E-Coli)

price2 :

205

size3 :

0.2 mg (E-Coli)

price3 :

515

size4 :

0.5 mg (E-Coli)

price4 :

845

size5 :

1 mg (E-Coli)

price5 :

1320

more info or order :

MyBioSource product webpage