product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Cathepsin G
catalog :
MBS718416
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS718416
products type :
Recombinant Protein
products full name :
Recombinant Mouse Cathepsin G
products short name :
Cathepsin G
products name syn :
Vimentin-specific protease; VSP
other names :
cathepsin G preproprotein; Cathepsin G; cathepsin G; cathepsin G; Vimentin-specific protease; VSP
products gene name :
Ctsg
other gene names :
Ctsg; Ctsg; VSP; CatG; VSP
uniprot entry name :
CATG_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
21-261; Mature full length protein
sequence length :
261
sequence :
IIGGREARPHSYPYMAFLLIQSPEGLSACGGFLVREDFV
LTAAHCLGSSINVTLGAHNIQMRERTQQLITVLRAIRHP
DYNPQNIRNDIMLLQLRRRARRSGSVKPVALPQASKKLQ
PGDLCTVAGWGRVSQSRGTNVLQEVQLRVQMDQMCANRF
QFYNSQTQICVGNPRERKSAFRGDSGGPLVCSNVAQGIV
SYGSNNGNPPAVFTKIQSFMPWIKRTMRRFAPRYQRPAN
SLSQAQT
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
This vimentin-specific protease may regulate the reorganization of vimentin filaments, occurring during cell differentiation, movent and mitosis.
products references :
Molecular cloning, chromosomal location, and tissue-specific expression of the murine cathepsin G gene.Heusel J.W., Scarpati E.M., Jenkins N.A., Gilbert D.J., Copeland N.G., Shapiro S.D., Ley T.J.Blood 81:1614-1623(1993) Kulmburg P., Baumruker T., Werner F.Huang R., Aveskogh M., Hellman L.T. Purification and characterization of a vimentin-specific protease in mouse myeloid leukemia cells. Regulation during differentiation and identity with cathepsin G.Nakamura N., Tsuru A., Hirayoshi K., Nagata K.Eur. J. Biochem. 205:947-954(1992)
ncbi gi num :
6681083
ncbi acc num :
NP_031826.1
ncbi gb acc num :
NM_007800.2
uniprot acc num :
P28293
ncbi mol weight :
42.88kD
ncbi pathways :
Activation Of Matrix Metalloproteinases Pathway (1323923); Amoebiasis Pathway (167330); Amoebiasis Pathway (167191); Degradation Of The Extracellular Matrix Pathway (1323922); Extracellular Matrix Organization Pathway (1323909); Lysosome Pathway (99272); Lysosome Pathway (96865); Metabolism Of Angiotensinogen To Angiotensins Pathway (1324211); Metabolism Of Proteins Pathway (1324154); Neuroactive Ligand-receptor Interaction Pathway (83250)
ncbi summary :
This gene encodes a member of the peptidase S1 (chymotrypsin) family of serine endopeptidases. The encoded preproprotein is proteolytically processed to generate a mature protein product. This product appears to play a role in host defense, including inflammation and antigen processing. Homozygous knockout mice for this gene exhibit enhanced susceptibility to bacterial and fungal infection. [provided by RefSeq, Aug 2015]
uniprot summary :
CTSG: Serine protease with trypsin- and chymotrypsin-like specificity. Cleaves complement C3. Has antibacterial activity against the Gram-negative bacterium P.aeruginosa, antibacterial activity is inhibited by LPS from P.aeruginosa, Z-Gly-Leu-Phe- CH2Cl and phenylmethylsulfonyl fluoride. Belongs to the peptidase S1 family. Protein type: Motility/polarity/chemotaxis; EC 3.4.21.20; Protease. Cellular Component: cytoplasm; extracellular matrix; extracellular space; intermediate filament; intracellular membrane-bound organelle; membrane; nucleus; plasma membrane; secretory granule. Molecular Function: heparin binding; hydrolase activity; peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity. Biological Process: defense response to fungus; defense response to Gram-positive bacterium; immune response; positive regulation of immune response; protein amino acid phosphorylation; protein processing; proteolysis; response to lipopolysaccharide
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.2 mg (E-Coli)
price2 :
490
size3 :
0.5 mg (E-Coli)
price3 :
715
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
1 mg (E-Coli)
price5 :
1170
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!