Recombinant Human Pro-neuregulin-3, membrane-bound isoform | MyBioSource MBS718407 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Pro-neuregulin-3, membrane-bound isoform

catalog :

MBS718407

quantity :

0.01 mg (E-Coli)

price :

110 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS718407

products type :

Recombinant Protein

products full name :

Recombinant Human Pro-neuregulin-3, membrane-bound isoform

products short name :

Pro-neuregulin-3

products name syn :

Pro-NRG3

other names :

Pro-neuregulin-3, membrane-bound isoform; pro-neuregulin-3, membrane-bound isoform; neuregulin 3

products gene name :

NRG3

other gene names :

NRG3; NRG3; HRG3; pro-NRG3; Pro-NRG3; NRG-3

uniprot entry name :

NRG3_HUMAN

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

1-360

sequence length :

696

sequence :

MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAGGGPD
GGGEGAAEPPRELRCSDCIVWNRQQTWLCVVPLFIGFIG
LGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSK
PSSFPKAMETTTTTTSTTSPATPSAGGAASSRTPNRIST
RLTTITRAPTRFPGHRVPIRASPRSTTARNTAAPATVPS
TTAPFFSSSTLGSRPPVPGTPSTQAMPSWPTAAYATSSY
LHDSTPSWTLSPFQDAASSSSSSSSSATTTTPETSTSPK
FHTTTYSTERSEHFKPCRDKDLAYCLNDGECFVIETLTG
SHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEFM
ESEEVYQRQ

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

other info2 :

Species: Homo sapiens (Human)

products categories :

Cancer

products description :

Direct ligand for the ERBB4 tyrosine kinase receptor. Binding results in ligand-stimulated tyrosine phosphorylation and activation of the receptor. Does not bind to the EGF receptor, ERBB2 or ERBB3 receptors. May be a survival factor for oligodendrocytes

products references :

Neuregulin-3 (NRG3): a novel neural tissue-enriched protein that binds and activates ErbB4." Zhang D., Sliwkowski M.X., Mark M., Frantz G., Akita R., Sun Y., Hillan K., Crowley C., Brush J., Godowski P.J. Proc. Natl. Acad. Sci. U.S.A. 94:9562-9567(1997)

ncbi gi num :

66730481

ncbi acc num :

NP_001010848.2

ncbi gb acc num :

NM_001010848.3

uniprot acc num :

P56975

ncbi mol weight :

53.76kD

ncbi pathways :

ARMS-mediated Activation Pathway (1269471); Adaptive Immune System Pathway (1269171); Axon Guidance Pathway (1270303); Constitutive Signaling By Aberrant PI3K In Cancer Pathway (1268880); Cytokine Signaling In Immune System Pathway (1269310); DAP12 Interactions Pathway (1269283); DAP12 Signaling Pathway (1269284); Developmental Biology Pathway (1270302); Disease Pathway (1268854); Diseases Of Signal Transduction Pathway (1268855)

ncbi summary :

This gene is a member of the neuregulin gene family. This gene family encodes ligands for the transmembrane tyrosine kinase receptors ERBB3 and ERBB4 - members of the epidermal growth factor receptor family. Ligand binding activates intracellular signaling cascades and the induction of cellular responses including proliferation, migration, differentiation, and survival or apoptosis. This gene encodes neuregulin 3 (NRG3). NRG3 has been shown to activate the tyrosine phosphorylation of its cognate receptor, ERBB4, and is thought to influence neuroblast proliferation, migration and differentiation by signalling through ERBB4. NRG3 also promotes mammary differentiation during embryogenesis. Linkage studies have implicated this gene as a susceptibility locus for schizophrenia and schizoaffective disorder. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described but their biological validity has not been verified.[provided by RefSeq, Sep 2009]

uniprot summary :

NRG3: Direct ligand for the ERBB4 tyrosine kinase receptor. Binding results in ligand-stimulated tyrosine phosphorylation and activation of the receptor. Does not bind to the EGF receptor, ERBB2 or ERBB3 receptors. May be a survival factor for oligodendrocytes. Belongs to the neuregulin family. 4 isoforms of the human protein are produced by alternative splicing. Protein type: Membrane protein, integral; Ligand, receptor tyrosine kinase. Chromosomal Location of Human Ortholog: 10q23.1. Cellular Component: extracellular region; extracellular space; integral to plasma membrane; intracellular. Molecular Function: chemorepellent activity; growth factor activity; receptor binding; receptor tyrosine kinase binding; transmembrane receptor protein tyrosine kinase activator activity. Biological Process: chemorepulsion involved in interneuron migration from the subpallium to the cortex; organ development; pattern specification process; regulation of cell growth; transmembrane receptor protein tyrosine kinase activation (dimerization)

size1 :

0.01 mg (E-Coli)

price1 :

110 USD

size2 :

0.05 mg (E-Coli)

price2 :

190

size3 :

0.2 mg (E-Coli)

price3 :

460

size4 :

0.5 mg (E-Coli)

price4 :

750

size5 :

0.05 mg (Baculovirus)

price5 :

1125

more info or order :

MyBioSource product webpage