Recombinant Mouse Lysyl oxidase homolog 2 | MyBioSource MBS718282 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Mouse Lysyl oxidase homolog 2

catalog :

MBS718282

quantity :

0.05 mg (E-Coli)

price :

185 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS718282

products type :

Recombinant Protein

products full name :

Recombinant Mouse Lysyl oxidase homolog 2

products short name :

Lysyl oxidase homolog 2

products name syn :

Lysyl oxidase-like protein 2

other names :

lysyl oxidase homolog 2; Lysyl oxidase homolog 2; lysyl oxidase homolog 2; lysyl oxidase-like 2; Lysyl oxidase-like protein 2

products gene name :

Loxl2

other gene names :

Loxl2; Loxl2; 1110004B06Rik; 4930526G11Rik; 9430067E15Rik

uniprot entry name :

LOXL2_MOUSE

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

26-776

sequence length :

776

sequence :

QYEGWPYQLQYPEYFQQPAPEHHQRQVPSDVVKIQVRLA
GQKRKHNEGRVEVYYEGQWGTVCDDDFSIHAAHVVCRQV
GYVEAKSWAASSSYGPGEGPIWLDNIYCTGKESTLASCS
SNGWGVTDCKHTEDVGVVCSEKRIPGFKFDNSLINQIES
LNIQVEDIRIRPILSAFRHRKPVTEGYVEVKEGKAWKQI
CNKHWTAKNSHVVCGMFGFPAEKTYNPKAYKTFASRRKL
RYWKFSMNCTGTEAHISSCKL

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Mediates the post-translational oxidative deamination of lysine residues on target proteins leading to the formation of deaminated lysine (allysine). When secreted in extracellular matrix, promotes cross-linking of extracellular matrix proteins by mediating oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Acts as a regulator of sprouting angiogenesis, probably via collagen IV scaffolding. When nuclear, acts as a transcription corepressor and specifically mediates deamination of trimethylated 'Lys-4' of histone H3 (H3K4me3), a specific tag for epigenetic transcriptional activation. Involved in epithelial to mesenchymal transition (T) via interaction with SNAI1 and participates in repression of E-cadherin, probably by mediating deamination of histone H3. Acts as a regulator of chondrocyte differentiation, probably by regulating expression of factors that control chondrocyte differentiation. 1 Publication

ncbi gi num :

225579028

ncbi acc num :

NP_201582.2

ncbi gb acc num :

NM_033325.2

uniprot acc num :

P58022

ncbi mol weight :

88.48kD

uniprot summary :

LOXL2: Mediates the post-translational oxidative deamination of lysine residues on target proteins leading to the formation of deaminated lysine (allysine). When secreted in extracellular matrix, promotes cross-linking of extracellular matrix proteins by mediating oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Acts as a regulator of sprouting angiogenesis, probably via collagen IV scaffolding. When nuclear, acts as a transcription corepressor and specifically mediates deamination of trimethylated 'Lys-4' of histone H3 (H3K4me3), a specific tag for epigenetic transcriptional activation. Involved in epithelial to mesenchymal transition (EMT) via interaction with SNAI1 and participates in repression of E- cadherin, probably by mediating deamination of histone H3. Also involved in E-cadherin repression following hypoxia, a hallmark of epithelial to mesenchymal transition believed to amplify tumor aggressiveness, suggesting that it may play a role in tumor progression. Acts as a regulator of chondrocyte differentiation, probably by regulating expression of factors that control chondrocyte differentiation. Belongs to the lysyl oxidase family. Protein type: Secreted; Cell adhesion; Oxidoreductase; EC 1.4.3.13; Secreted, signal peptide. Cellular Component: basement membrane; chromosome; extracellular region; extracellular space; membrane; nucleoplasm; nucleus; proteinaceous extracellular matrix. Molecular Function: chromatin binding; copper ion binding; metal ion binding; methylated histone residue binding; oxidoreductase activity; oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor; protein-lysine 6-oxidase activity; scavenger receptor activity; transcription corepressor activity. Biological Process: chromatin modification; collagen fibril organization; endothelial cell migration; endothelial cell proliferation; epithelial to mesenchymal transition; histone modification; negative regulation of transcription, DNA-dependent; positive regulation of chondrocyte differentiation; protein amino acid deamination; protein modification process; regulation of transcription, DNA-dependent; response to copper ion; response to hypoxia; sprouting angiogenesis; transcription, DNA-dependent

size1 :

0.05 mg (E-Coli)

price1 :

185 USD

size2 :

0.2 mg (E-Coli)

price2 :

420

size3 :

0.5 mg (E-Coli)

price3 :

680

size4 :

1 mg (E-Coli)

price4 :

1070

more info or order :

MyBioSource product webpage