protein

Recombinant Human Receptor-type tyrosine-protein phosphatase C

MBS718210

0.01 mg (E-Coli)

160 USD

Recombinant Protein

Recombinant Human Receptor-type tyrosine-protein phosphatase C

[Receptor-type tyrosine-protein phosphatase C]

[Leukocyte common antigen; L-CAT200; CD45]

[receptor-type tyrosine-protein phosphatase C isoform 1; Receptor-type tyrosine-protein phosphatase C; receptor-type tyrosine-protein phosphatase C; protein tyrosine phosphatase, receptor type C; Leukocyte common antigen; L-CA; T200; CD_antigen: CD45]

[PTPRC]

[PTPRC; PTPRC; LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180; CD45; L-CA]

PTPRC_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

[24-575aa; Extracellular Domain]

575

QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFE
RENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGVSS
VQTPHLPTHADSQTPSAGTDTQTFSGSAANAKLNPTPGS
NAISDVPGERSTASTFPTDPVSPLTTTLSLAHHSSAALP
ARTSNTTITANTSDAYLNASETTTLSPSGSAVISTTTIA
TTPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVE
CGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILD
VPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQN
ITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNH
KFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPP
QRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTK
YVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTV
SMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNE
SHKNCDFRVKDLQYSTDYTFKAYFHNGDYPGEPFILHHS
TSYNSK

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to support@mybiosource.com for more details.

Immunology

Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one ses to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN. Dephosphorylates LYN, and thereby modulates LYN activity.

Differential usage of three exons generates at least five different mRNAs encoding human leukocyte common antigens.Streuli M., Hall L.R., Saga Y., Schlossman S.F., Saito H.J. Exp. Med. 166:1548-1566(1987) Structural variants of human T200 glycoprotein (leukocyte-common antigen) .Ralph S.J., Thomas M.L., Morton C.C., Trowbridge I.S.EMBO J. 6:1251-1257(1987) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Integrity of the exon 6 sequence is essential for tissue-specific alternative splicing of human leukocyte common antigen pre-mRNA.Tsai A.Y.M., Streuli M., Saito H.Mol. Cell. Biol. 9:4550-4555(1989) Complete exon-intron organization of the human leukocyte common antigen (CD45) gene.Hall L.R., Streuli M., Schlossman S.F., Saito H.J. Immunol. 141:2781-2787(1988) The leukocyte common antigen (CD45) a putative receptor-linked protein tyrosine phosphatase.Charbonneau H., Tonks N.K., Walsh K.A., Fischer E.H.Proc. Natl. Acad. Sci. U.S.A. 85:7182-7186(1988) Distinct functional roles of the two intracellular phosphatase like domains of the receptor-linked protein tyrosine phosphatases LCA and LAR.Streuli M., Krueger N.X., Thai T., Tang M., Saito H.EMBO J. 9:2399-2407(1990) SKAP55 coupled with CD45 positively regulates T-cell receptor-mediated gene transcription.Wu L., Fu J., Shen S.-H.Mol. Cell. Biol. 22:2673-2686(2002) A role for interleukin-12 in the regulation of T cell plasma membrane compartmentation.Salgado F.J., Lojo J., Alonso-Lebrero J.L., Lluis C., Franco R., Cordero O.J., Nogueira M.J. Biol. Chem. 278:24849-24857(2003) Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J.J. Proteome Res. 7:5167-5176(2008) Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.J. Proteome Res. 8:651-661(2009) Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.Nat. Biotechnol. 27:378-386(2009) Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.Sci. Signal. 2:RA46-RA46(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) The human cytomegalovirus UL11 protein interacts with the receptor tyrosine phosphatase CD45, resulting in functional paralysis of T cells.Gabaev I., Steinbrueck L., Pokoyski C., Pich A., Stanton R.J., Schwinzer R., Schulz T.F., Jacobs R., Messerle M., Kay-Fedorov P.C.PLoS Pathog. 7:E1002432-E1002432(2011) Structural basis for the function and regulation of the receptor protein tyrosine phosphatase CD45.Nam H.J., Poy F., Saito H., Frederick C.A.J. Exp. Med. 201:441-452(2005) A point mutation in PTPRC is associated with the development of multiple sclerosis.Jacobsen M., Schweer D., Ziegler A., Gaber R., Schock S., Schwinzer R., Wonigeit K., Lindert R.-B., Kantarci O., Schaefer-Klein J., Schipper H.I., Oertel W.H., Heidenreich F., Weinshenker B.G., Sommer N., Hemmer B.Nat. Genet. 26:495-499(2000) A deletion in the gene encoding the CD45 antigen in a patient with SCID.Tchilian E.Z., Wallace D.L., Wells R.S., Flower D.R., Morgan G., Beverley P.C.L.J. Immunol. 166:1308-1313(2001) The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006)

392307007

NP_002829.3

NM_002838.4

P08575

62.78kD

Adaptive Immune System Pathway (1269171); Axon Guidance Pathway (1270303); B Cell Receptor Signaling Pathway (198909); BCR Signaling Pathway (138058); CXCR4-mediated Signaling Events Pathway (137910); Cell Adhesion Molecules (CAMs) Pathway (83069); Cell Adhesion Molecules (CAMs) Pathway (480); Developmental Biology Pathway (1270302); EPO Receptor Signaling Pathway (198882); Fc Gamma R-mediated Phagocytosis Pathway (114228)

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus is classified as a receptor type PTP. This PTP has been shown to be an essential regulator of T- and B-cell antigen receptor signaling. It functions through either direct interaction with components of the antigen receptor complexes, or by activating various Src family kinases required for the antigen receptor signaling. This PTP also suppresses JAK kinases, and thus functions as a regulator of cytokine receptor signaling. Alternatively spliced transcripts variants of this gene, which encode distinct isoforms, have been reported. [provided by RefSeq, Jun 2012]

CD45: a receptor type protein tyrosine phosphatase protein. Contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains. The first PTPAse domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Specifically expressed in hematopoietic cells. An essential regulator of T- and B-cell antigen receptor signaling. Functions through either direct interaction with components of the antigen receptor complexes, or by activating various Src family kinases required for the antigen receptor signaling. Suppresses JAK kinases, and thus functions as a regulator of cytokine receptor signaling. Four alternatively spliced isoforms have been described. Protein type: EC 3.1.3.48; Motility/polarity/chemotaxis; Membrane protein, integral; Receptor protein phosphatase, tyrosine. Chromosomal Location of Human Ortholog: 1q31-q32. Cellular Component: cell surface; external side of plasma membrane; focal adhesion; integral to plasma membrane; intracellular; lipid raft; membrane; plasma membrane. Molecular Function: protein binding; protein kinase binding; protein tyrosine phosphatase activity; transmembrane receptor protein tyrosine phosphatase activity. Biological Process: axon guidance; B cell proliferation; B cell receptor signaling pathway; bone marrow development; cell surface receptor linked signal transduction; defense response to virus; dephosphorylation; hemopoietic progenitor cell differentiation; immunoglobulin biosynthetic process; negative regulation of cytokine and chemokine mediated signaling pathway; negative regulation of protein kinase activity; negative regulation of T cell mediated cytotoxicity; positive regulation of antigen receptor-mediated signaling pathway; positive regulation of B cell proliferation; positive regulation of protein kinase activity; positive regulation of T cell proliferation; protein amino acid dephosphorylation; regulation of cell cycle; release of sequestered calcium ion into cytosol; stem cell development; substrate-bound cell migration, cell release from substrate; T cell differentiation; T cell receptor signaling pathway. Disease: Hepatitis C Virus, Susceptibility To; Severe Combined Immunodeficiency, Autosomal Recessive, T Cell-negative, B Cell-positive, Nk Cell-positive

0.01 mg (E-Coli)

160 USD

0.05 mg (E-Coli)

200

0.1 mg (E-Coli)

295

0.2 mg (E-Coli)

480

0.5 mg (E-Coli)

790

1 mg (E-Coli)

1215