product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Pig Complement C5a anaphylatoxin
catalog :
MBS718153
quantity :
0.05 mg (Yeast)
price :
185 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS718153
products type :
Recombinant Protein
products full name :
Recombinant Pig Complement C5a anaphylatoxin
products short name :
Complement C5a anaphylatoxin
other names :
Complement C5a anaphylatoxin; Complement C5a anaphylatoxin
products gene name :
C5
other gene names :
C5
uniprot entry name :
CO5_PIG
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
Jan-74
sequence length :
74
sequence :
MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAA
RIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
products description :
Derived from proteolytic degradation of complent C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
products references :
Amino acid sequence of the anaphylatoxin from the fifth component of porcine complement.Gerard C., Hugli T.E.J. Biol. Chem. 255:4710-4715(1980) Identification of classical anaphylatoxin as the des-Arg form of the C5a molecule evidence of a modulator role for the oligosaccharide unit in human des-Arg74-C5a.Gerard C., Hugli T.E.Proc. Natl. Acad. Sci. U.S.A. 78:1833-1837(1981) Three-dimensional structure of porcine C5adesArg from 1H nuclear magnetic resonance data.Williamson M.P., Madison V.S.Biochemistry 29:2895-2905(1990)
ncbi gi num :
116605
ncbi acc num :
P01032.1
uniprot acc num :
P01032
ncbi mol weight :
10.6kD
size1 :
0.05 mg (Yeast)
price1 :
185 USD
size2 :
0.2 mg (Yeast)
price2 :
420
size3 :
0.5 mg (Yeast)
price3 :
680
size4 :
1 mg (Yeast)
price4 :
1070
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!