RIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR

San Diego, CA 92195-3308
"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."
Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...
"MyBioSource offers the best products at unbeatable prices."
Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.
Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!
- Recombinant Human Type-2 angiotensin II receptor | MBS718428
- Recombinant Human Insulin-like growth factor-binding protein 3 | MBS718617
- Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 beta (IL1B) | MBS718626
- Recombinant Macaca mulatta (Rhesus macaque) Cytochrome c (CYCS) | MBS718743
- Recombinant Human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delt ...
