product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Mouse Homeobox protein Nkx-2.2
catalog :
MBS717971
quantity :
0.01 mg (E-Coli)
price :
110 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717971
products type :
Recombinant Protein
products full name :
Recombinant Mouse Homeobox protein Nkx-2.2
products short name :
Homeobox protein Nkx-2.2
products name syn :
Homeobox protein NK-2 homolog B
other names :
homeobox protein Nkx-2.2 isoform 1; Homeobox protein Nkx-2.2; homeobox protein Nkx-2.2; NK2 homeobox 2; Homeobox protein NK-2 homolog B
products gene name :
Nkx2-2
other gene names :
Nkx2-2; Nkx2-2; Nkx2.2; tinman; Nkx-2.2; Nkx-2.2; Nkx2b
uniprot entry name :
NKX22_MOUSE
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
1-273
sequence length :
273
sequence :
MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGP
EPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLA
STEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKE
TQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAP
EREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVT
PLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPF
SAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Mus musculus (Mouse)
products description :
Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter.
products references :
Regional expression of the homeobox gene Nkx-2.2 in the developing mammalian forebrain." Price M., Lazzaro D., Pohl T., Mattei M.-G., Ruether U., Olivo J.-C., Duboule D., di Lauro R. Neuron 8:241-255(1992)
ncbi gi num :
6754860
ncbi acc num :
NP_035049.1
ncbi gb acc num :
NM_010919.2
uniprot acc num :
P42586
ncbi mol weight :
46.11kD
ncbi pathways :
Developmental Biology Pathway (1323597); Dopminergic Neurogenesis Pathway (198342); Maturity Onset Diabetes Of The Young Pathway (83293); Maturity Onset Diabetes Of The Young Pathway (508); Regulation Of Beta-cell Development Pathway (1323631); Regulation Of Gene Expression In Endocrine-committed (NEUROG3+) Progenitor Cells Pathway (1323632); SIDS Susceptibility Pathways (198328)
uniprot summary :
NKX2-2: Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter. Belongs to the NK-2 homeobox family. Protein type: Cell development/differentiation; Transcription factor. Cellular Component: intracellular; nucleus. Molecular Function: chromatin binding; DNA binding; protein binding; sequence-specific DNA binding; transcription coactivator activity; transcription factor activity; transcription factor binding. Biological Process: astrocyte differentiation; cell development; cell differentiation; endocrine pancreas development; gut development; multicellular organismal development; negative regulation of neuron differentiation; nervous system development; neuron fate specification; oligodendrocyte development; positive regulation of cell differentiation; positive regulation of neuron differentiation; positive regulation of oligodendrocyte differentiation; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; regulation of cell differentiation; regulation of transcription, DNA-dependent; smoothened signaling pathway; spinal cord motor neuron differentiation; spinal cord oligodendrocyte cell differentiation; spinal cord oligodendrocyte cell fate specification; transcription, DNA-dependent
size1 :
0.01 mg (E-Coli)
price1 :
110 USD
size2 :
0.05 mg (E-Coli)
price2 :
190
size3 :
0.2 mg (E-Coli)
price3 :
460
size4 :
0.5 mg (E-Coli)
price4 :
750
size5 :
0.05 mg (Baculovirus)
price5 :
1025
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!