Recombinant Human Claudin-3 | MyBioSource MBS717959 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Human Claudin-3

catalog :

MBS717959

quantity :

0.05 mg (E-Coli)

price :

180 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717959

products type :

Recombinant Protein

products full name :

Recombinant Human Claudin-3

products short name :

Claudin-3

products name syn :

Clostridium perfringens enterotoxin receptor 2; CPE-R 2; CPE-receptor 2; Rat ventral prostate, 1 protein homolog; hRVP1

other names :

claudin-3; Claudin-3; claudin-3; claudin 3; Clostridium perfringens enterotoxin receptor 2; CPE-R 2; CPE-receptor 2; Rat ventral prostate.1 protein homolog; hRVP1

products gene name :

CLDN3

products gene name syn :

C7orf1; CPETR2

other gene names :

CLDN3; CLDN3; RVP1; HRVP1; C7orf1; CPE-R2; CPETR2; C7orf1; CPETR2; CPE-R 2; CPE-receptor 2; hRVP1

uniprot entry name :

CLD3_HUMAN

host :

E Coli

sequence positions :

30-80

sequence length :

220

sequence :

RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDS
LLALPQDLQAAR

purity :

Greater than 90% as determined by SDS-PAGE.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products categories :

Metabolism

products description :

Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

products references :

Analysis of a human gene homologous to rat ventral prostate.1 protein.Peacock R.E., Keen T.J., Inglehearn C.F.Genomics 46:443-449(1997) Clostridium perfringens enterotoxin utilizes two structurally related membrane proteins as functional receptors in vivo.Katahira J., Sugiyama H., Inoue N., Horiguchi Y., Matsuda M., Sugimoto N.J. Biol. Chem. 272:26652-26658(1997) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

ncbi gi num :

4502875

ncbi acc num :

NP_001297.1

ncbi gb acc num :

NM_001306.3

uniprot acc num :

O15551

ncbi mol weight :

33.1kD

ncbi pathways :

Cell Adhesion Molecules (CAMs) Pathway (83069); Cell Adhesion Molecules (CAMs) Pathway (480); Cell Junction Organization Pathway (1270232); Cell-Cell Communication Pathway (1270231); Cell-cell Junction Organization Pathway (1270233); Hepatitis C Pathway (173973); Hepatitis C Pathway (173907); Leukocyte Transendothelial Migration Pathway (83083); Leukocyte Transendothelial Migration Pathway (494); Tight Junction Pathway (83071)

ncbi summary :

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this intronless gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is also a low-affinity receptor for Clostridium perfringens enterotoxin, and shares aa sequence similarity with a putative apoptosis-related protein found in rat. [provided by RefSeq, Jul 2008]

uniprot summary :

Claudin-3: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium- independent cell-adhesion activity. CLDN3 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Belongs to the claudin family. Protein type: Cytoskeletal; Membrane protein, integral; Membrane protein, multi-pass. Chromosomal Location of Human Ortholog: 7q11.23. Cellular Component: apicolateral plasma membrane; integral to membrane; integral to plasma membrane; lateral plasma membrane; tight junction. Molecular Function: identical protein binding; structural molecule activity; transmembrane receptor activity. Biological Process: calcium-independent cell-cell adhesion; protein heterooligomerization; protein homooligomerization; response to hypoxia; signal transduction

size1 :

0.05 mg (E-Coli)

price1 :

180 USD

size2 :

0.2 mg (E-Coli)

price2 :

410

size3 :

0.5 mg (E-Coli)

price3 :

665

size4 :

1 mg (E-Coli)

price4 :

1050

more info or order :

MyBioSource product webpage