Recombinant Macaca mulatta (Rhesus macaque) Microtubule-associated protein tau (MAPT) | MyBioSource MBS717900 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Macaca mulatta (Rhesus macaque) Microtubule-associated protein tau (MAPT)

catalog :

MBS717900

quantity :

1 mg (E-Coli)

price :

1965 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717900

products type :

Recombinant Protein

products full name :

Recombinant Macaca mulatta (Rhesus macaque) Microtubule-associated protein tau (MAPT)

products short name :

(Rhesus macaque) Microtubule-associated protein tau (MAPT)

products name syn :

Recombinant (Rhesus macaque) Microtubule-associated protein tau (MAPT); Microtubule-associated protein tau; Neurofibrillary tangle protein Paired helical filament-tau; PHF-tau

other names :

Microtubule-associated protein tau; Microtubule-associated protein tau; Neurofibrillary tangle protein; Paired helical filament-tau

products gene name syn :

MAPT; TAU

other gene names :

MAPT; TAU; PHF-tau

uniprot entry name :

TAU_MACMU

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

2-459

sequence length :

459

sequence :

AEPRQEFDVMEDHAGTYGLGDRKDQEGYTMLQDQEGDTD
AGLKESPLQTPAEDGSEELGSETSDAKSTPTAEDVTAPL
VDERAPGEQAAAQPHMEIPEGTTAEEAGIGDTPSLEDEA
AGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGA
APPGQKGQANATRIPAKTPPAPKTPPSSATKQVQRKPPP
AEPTSERGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPT
PPAREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNV
KSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKD
NIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGG
GQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIET
HKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVS
STGSIDMVDSPQLATLADEVSASLAKQGL

purity :

>90%(SDS-PAGE)

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C. For extended storage, store at -20 or -80 degree C. Note: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree for up to one week.

other info1 :

Species: Macaca mulatta (Rhesus macaque)

products description :

Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.

ncbi gi num :

13431910

ncbi acc num :

P57786.2

uniprot acc num :

P57786

ncbi mol weight :

65KD

ncbi pathways :

Focal Adhesion Pathway (83067); Focal Adhesion Pathway (478); MAPK Signaling Pathway (83048); MAPK Signaling Pathway (456); Salmonella Infection Pathway (375172); Salmonella Infection Pathway (375149)

uniprot summary :

Function: Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization. Subunit structure: Interacts with SQSTM1 when polyubiquitinated. Interacts with PSMC2 through SQSTM1 . By similarity. Interacts with FKBP4. Binds to CSNK1D . By similarity. Subcellular location: Cytoplasm cytosol. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm cytoskeleton. Cell projection axon. Note: Mostly found in the axons of neurons, in the cytosol and in association with plasma membrane components. Tissue specificity: Expressed in neurons. Domain: The tau/MAP repeat binds to tubulin. Type I isoforms contain 3 repeats while type II isoforms contain 4 repeats. Post-translational modification: Polyubiquitinated. Requires functional TRAF6 and may provoke SQSTM1-dependent degradation by the proteasome . By similarity.Phosphorylation at various serine and threonine residues in S-P or T-P motifs by proline-directed protein kinases (PDPK1: CDK1, CDK5, GSK3, MAPK) (a few sites per protein in interphase, more in mitosis), and at serine residues in K-X-G-S motifs by MAP/microtubule affinity-regulating kinase (MARK1 or MARK2), causing detachment from microtubules, and their disassembly. Phosphorylation at Ser-280 by BRSK1 and BRSK2 in neurons affects ability to bind microtubules and plays a role in neuron polarization. Phosphorylated by PHK . By similarity. Sequence similarities: Contains 4 Tau/MAP repeats.

size1 :

1 mg (E-Coli)

price1 :

1965 USD

size2 :

1 mg (Yeast)

price2 :

2425

more info or order :

MyBioSource product webpage