protein

Recombinant Rat Calcium/calmodulin-dependent protein kinase type IV

MBS717890

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Rat Calcium/calmodulin-dependent protein kinase type IV

Calcium/calmodulin-dependent protein kinase type IV

CaM kinase-GR; Calspermin

calcium/calmodulin-dependent protein kinase type IV; Calcium/calmodulin-dependent protein kinase type IV; calcium/calmodulin-dependent protein kinase type IV; calcium/calmodulin-dependent protein kinase IV; CaM kinase-GR; Calspermin

Camk4

Camk4; Camk4; Ccdpk; RATCCDPK; CaMK IV

KCC4_RAT

E Coli or Yeast or Baculovirus or Mammalian Cell

1-474

474

MLKVTVPSCPSSPCSSVTSSTENLVPDYWIDGSKRDPLS
DFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKKTVD
KKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLELV
TGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGI
VHRDLKPENLLYATPAPDAPLKIADFGLSKIVEHQVLMK
TVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGF
EPFYDERGDQFMFRRILNCEY

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Isoform 1: Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK4 signaling cascade and regulates, mainly by phosphorylation, the activity of several transcription activators, such as CREB1, MEF2D, JUN and RORA, which play pivotal roles in immune response, inflammation, and mory consolidation. In the thymus, regulates the CD4+/CD8+ double positive thymocytes selection threshold during T-cell ontogeny. In CD4 mory T-cells, is required to link T-cell antigen receptor (TCR) signaling to the production of IL2, IFNG and IL4 (through the regulation of CREB and MEF2). Regulates the differentiation and survival phases of osteoclasts and dendritic cells (DCs). Mediates DCs survival by linking TLR4 and the regulation of tporal expression of BCL2. Phosphorylates the transcription activator CREB1 on 'Ser-133' in hippocampal neuron nuclei and contribute to mory consolidation and long term potentiation (LTP) in the hippocampus. Can activate the MAP kinases MAPK1/ERK2, MAPK8/JNK1 and MAPK14/p38 and stimulate transcription through the phosphorylation of ELK1 and ATF2. Can also phosphorylate in vitro CREBBP, PRM2, MEF2A and STMN1/OP18. Isoform 2: Heat-stable, acidic, calmodulin-binding protein.

Relationship of genes encoding Ca2+/calmodulin-dependent protein kinase Gr and calspermin a gene within a gene.Ohmstede C.-A., Bland M.M., Merrill B.M., Sahyoun N.Proc. Natl. Acad. Sci. U.S.A. 88:5784-5788(1991) A novel Ca2+/calmodulin-dependent protein kinase and a male germ cell-specific calmodulin-binding protein are derived from the same gene.Means A.R., Cruzalegui F., Lemagueresse B., Needleman D.S., Slaughter G.R., Ono T.Mol. Cell. Biol. 11:3960-3971(1991) Cloning and sequencing of a gene encoding the beta polypeptide of Ca2+/calmodulin-dependent protein kinase IV and its expression confined to the mature cerebellar granule cells.Sakagami H., Kondo H.Brain Res. Mol. Brain Res. 19:215-218(1993) Organization and analysis of the complete rat calmodulin-dependent protein kinase IV gene.Sun Z., Means R.L., Le;Magueresse B., Means A.R.J. Biol. Chem. 270:29507-29514(1995) Ca2+/calmodulin-dependent protein kinase enriched in cerebellar granule cells. Identification of a novel neuronal calmodulin-dependent protein kinase.Ohmstede C.-A., Jenson K.F., Sahyoun N.J. Biol. Chem. 264:5866-5875(1989) Molecular cloning sequence and distribution of rat calspermin, a high affinity calmodulin-binding protein.Ono T., Slaughter G.R., Cook R.G., Means A.R.J. Biol. Chem. 264:2081-2087(1989) CREB a Ca(2+) -regulated transcription factor phosphorylated by calmodulin-dependent kinases.Sheng M., Thompson M.A., Greenberg M.E.Science 252:1427-1430(1991) Activation mechanisms for Ca2+/calmodulin-dependent protein kinase IV. Identification of a brain CaM-kinase IV kinase.Tokumitsu H., Brickey D.A., Glod J., Hidaka H., Sikela J., Soderling T.R.J. Biol. Chem. 269:28640-28647(1994) Calcium/calmodulin-dependent protein kinase types II and IV differentially regulate CREB-dependent gene expression.Matthews R.P., Guthrie C.R., Wailes L.M., Zhao X., Means A.R., McKnight G.S.Mol. Cell. Biol. 14:6107-6116(1994) Full activation of brain calmodulin-dependent protein kinase IV requires phosphorylation of the amino-terminal serine-rich region by calmodulin-dependent protein kinase IV kinase.Okuno S., Kitani T., Fujisawa H.J. Biochem. 117:686-690(1995) Phosphorylation and activation of Ca(2+) -calmodulin-dependent protein kinase IV by Ca(2+) -calmodulin-dependent protein kinase Ia kinase. Phosphorylation of threonine 196 is essential for activation.Selbert M.A., Anderson K.A., Huang Q.H., Goldstein E.G., Means A.R., Edelman A.M.J. Biol. Chem. 270:17616-17621(1995) Regulation of activating transcription factor-1 and the cAMP response element-binding protein by Ca2+/calmodulin-dependent protein kinases type I, II, and IV.Sun P., Lou L., Maurer R.A.J. Biol. Chem. 271:3066-3073(1996) Inactivation of calmodulin-dependent protein kinase IV by autophosphorylation of serine 332 within the putative calmodulin-binding domain.Watanabe S., Okuno S., Kitani T., Fujisawa H.J. Biol. Chem. 271:6903-6910(1996) Multiple Ca(2+) -calmodulin-dependent protein kinase kinases from rat brain. Purification, regulation by Ca(2+) -calmodulin, and partial amino acid sequence.Edelman A.M., Mitchelhill K.I., Selbert M.A., Anderson K.A., Hook S.S., Stapleton D., Goldstein E.G., Means A.R., Kemp B.E.J. Biol. Chem. 271:10806-10810(1996) Components of a calmodulin-dependent protein kinase cascade. Molecular cloning, functional characterization and cellular localization of Ca2+/calmodulin-dependent protein kinase kinase beta.Anderson K.A., Means R.L., Huang Q.-H., Kemp B.E., Goldstein E.G., Selbert M.A., Edelman A.M., Fremeau R.T., Means A.R.J. Biol. Chem. 273:31880-31889(1998) A signaling complex of Ca2+-calmodulin-dependent protein kinase IV and protein phosphatase 2A.Westphal R.S., Anderson K.A., Means A.R., Wadzinski B.E.Science 280:1258-1261(1998) Substrate recognition by Ca2+/Calmodulin-dependent protein kinase kinase. Role of the arg-pro-rich insert domain.Tokumitsu H., Takahashi N., Eto K., Yano S., Soderling T.R., Muramatsu M.-A.J. Biol. Chem. 274:15803-15810(1999) Catalytic activity is required for calcium/calmodulin-dependent protein kinase IV to enter the nucleus.Lemrow S.M., Anderson K.A., Joseph J.D., Ribar T.J., Noeldner P.K., Means A.R.J. Biol. Chem. 279:11664-11671(2004)

77404384

NP_036859.2

NM_012727.3

P13234

57.2kD

Activation Of CaMK IV Pathway (1333604); Activation Of NMDA Receptor Upon Glutamate Binding And Postsynaptic Events Pathway (1333595); Alcoholism Pathway (585585); Alcoholism Pathway (587116); Aldosterone Synthesis And Secretion Pathway (1273357); Aldosterone Synthesis And Secretion Pathway (1285075); Amphetamine Addiction Pathway (547642); Amphetamine Addiction Pathway (550546); CREB Phosphorylation Through The Activation Of CaMKK Pathway (1333603); Ca-dependent Events Pathway (1333978)

protein kinase that phosphorylates synapsin I; involved in neuronal calcium signaling; alternative transcript produces calspermin protein [RGD, Feb 2006]

CAMK4: a protein kinase of the CAMK1 family. Implicated in transcriptional regulation in lymphocytes, neurons and male germ cells. Two alternatively sliced isoforms have been described. Protein type: Protein kinase, CAMK; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.17; CAMK group; CAMK1 family. Cellular Component: cytoplasm; cytosol; nucleolus; nucleoplasm; nucleus. Molecular Function: ATP binding; calcium-dependent protein serine/threonine kinase activity; calmodulin binding; calmodulin-dependent protein kinase activity. Biological Process: adaptive immune response; inflammatory response; long-term memory; myeloid dendritic cell cytokine production; myeloid dendritic cell differentiation; nerve-nerve synaptic transmission; nucleocytoplasmic transport; peptidyl-serine phosphorylation; positive regulation of protein export from nucleus; positive regulation of transcription, DNA-dependent; protein amino acid autophosphorylation; protein amino acid phosphorylation; signal transduction

0.05 mg (E-Coli)

190 USD

0.2 mg (E-Coli)

460

0.5 mg (E-Coli)

750

1 mg (E-Coli)

1180

0.05 mg (Baculovirus)

1260