product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Rat Transforming growth factor beta-1
catalog :
MBS717883
quantity :
0.05 mg (E-Coli)
price :
180 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717883
products type :
Recombinant Protein
products full name :
Recombinant Rat Transforming growth factor beta-1
products short name :
Transforming growth factor beta-1
products name syn :
Cleaved into the following chain: 1. Latency-associated peptide; 2. LAP
other names :
transforming growth factor beta-1; Transforming growth factor beta-1; transforming growth factor beta-1; transforming growth factor, beta 1
products gene name :
Tgfb1
other gene names :
Tgfb1; Tgfb1; Tgfb; TGF-beta-1; LAP
uniprot entry name :
TGFB1_RAT
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
30-278; Latency-associated peptide chain.
sequence length :
278
sequence :
LSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEV
PPGPLPEAVLALYNSTRDRVAGESADPEPEPEADYYAKE
VTRVLMVDRNNAIYDKTKDITHSIYMFFNTSDIREAVPE
PPLLSRAELRLQRFKSTVEQHVELYQKYSNNSWRYLGNR
LLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCS
CDSKDNVLHVEINGISPKRRGDLGTIHDMNRPFLLLMAT
PLERAQHLHSSRHRR
purity :
Greater than 90% as determined by SDS-PAGE.
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
other info2 :
Species: Rat
products categories :
Signal Transduction
products description :
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. Can promote either T-helper 17 cells (Th17) or regulatory T-cells (Treg) lineage differentiation in a concentration-dependent manner. At high concentrations, leads to FOXP3-mediated suppression of RORC and down-regulation of IL-17 expression, favoring Treg cell development. At low concentrations in concert with IL-6 and IL-21, leads to expression of the IL-17 and IL-23 receptors, favoring differentiation to Th17 cells.
products references :
cDNA cloning by PCR of rat transforming growth factor beta-1." Qian S.W., Kondaiah P., Roberts A.B., Sporn M.B. Nucleic Acids Res. 18:3059-3059(1990)
ncbi gi num :
11024652
ncbi acc num :
NP_067589.1
ncbi gb acc num :
NM_021578.2
uniprot acc num :
P17246
ncbi mol weight :
44.48kD
ncbi pathways :
AGE-RAGE Signaling Pathway In Diabetic Complications (1320189); AGE-RAGE Signaling Pathway In Diabetic Complications (1319775); Adipogenesis Pathway (198479); Amoebiasis Pathway (167311); Amoebiasis Pathway (167191); Cell Cycle Pathway (198428); Cell Cycle Pathway (83446); Cell Cycle Pathway (463); Chagas Disease (American Trypanosomiasis) Pathway (147806); Chagas Disease (American Trypanosomiasis) Pathway (147795)
ncbi summary :
binds the TGFbeta receptor; plays a role in regulation of cell growth and proliferation; induces synthesis of extracellular matrix proteins and may play a role in fibrosis [RGD, Feb 2006]
size1 :
0.05 mg (E-Coli)
price1 :
180 USD
size2 :
0.2 mg (E-Coli)
price2 :
490
size3 :
0.5 mg (E-Coli)
price3 :
715
size4 :
0.05 mg (Baculovirus)
price4 :
950
size5 :
1 mg (E-Coli)
price5 :
1170
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!