protein

Recombinant Human Yorkie homolog

MBS717875

0.05 mg (E-Coli)

180 USD

Recombinant Protein

Recombinant Human Yorkie homolog

Yorkie homolog

Protein yorkie homolog; Yes-associated protein YAP65 homolog

transcriptional coactivator YAP1 isoform 1; Transcriptional coactivator YAP1; transcriptional coactivator YAP1; Yes associated protein 1; Protein yorkie homolog; Yes-associated protein YAP65 homolog

YAP1

YAP1; YAP1; YAP; YKI; COB1; YAP2; YAP65; YAP65; Yes-associated protein 1

YAP1_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-504; Full length

504

MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPA
ATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTA
NVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGA
LTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPT
AQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQ
TTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPD
GWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRI
SQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQ
MEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQ
LPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGT
YHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTI
NQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGE
ELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Cancer

Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (T) induction. Isoform 2 and isoform 3 can activate the C-terminal fragment (CTF) of ERBB4 (isoform 3).

Characterization of the mammalian YAP (Yes-associated protein) gene and its role in defining a novel protein module, the WW domain.Sudol M., Bork P., Einbond A., Kastury K., Druck T., Negrini M., Huebner K., Lehman D.J. Biol. Chem. 270:14733-14741(1995) WW domain-containing protein YAP associates with ErbB-4 and acts as a co-transcriptional activator for the carboxyl-terminal fragment of ErbB-4 that translocates to the nucleus.Komuro A., Nagai M., Navin N.E., Sudol M.J. Biol. Chem. 278:33334-33341(2003) YAP is a candidate oncogene for esophageal squamous-cell carcinoma.Inazawa J., Imoto I., Muramatsu T. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)

194306653

NP_001123617.1

NM_001130145.2

P46937

56.4kD

ErbB4 Signaling Events Pathway (137991); Fatty Acid, Triacylglycerol, And Ketone Body Metabolism Pathway (1270010); Gene Expression Pathway (1269649); Generic Transcription Pathway (1269650); Hippo Signaling Pathway (1084759); Hippo Signaling Pathway (1108222); Hippo Signaling Pathway (749777); Hippo Signaling Pathway (750388); Metabolism Pathway (1269956); Metabolism Of Lipids And Lipoproteins Pathway (1270001)

This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2013]

0.05 mg (E-Coli)

180 USD

0.05 mg (Yeast)

260

0.2 mg (E-Coli)

490

0.2 mg (Yeast)

600

0.5 mg (E-Coli)

715