Recombinant Rat Glutathione S-transferase P | MyBioSource MBS717854 product information

product summary

company name :

MyBioSource

product type :

protein

product name :

Recombinant Rat Glutathione S-transferase P

catalog :

MBS717854

quantity :

0.05 mg (E-Coli)

price :

190 USD

more info or order :

MyBioSource product webpage

product information

catalog number :

MBS717854

products type :

Recombinant Protein

products full name :

Recombinant Rat Glutathione S-transferase P

products short name :

Glutathione S-transferase P

products name syn :

Chain 7GST 7-7GST class-pi

other names :

glutathione S-transferase P; Glutathione S-transferase P; glutathione S-transferase P; glutathione S-transferase pi 1; Chain 7; GST 7-7; GST class-pi

products gene name :

Gstp1

other gene names :

Gstp1; Gstp1; Gst3; Gstp; GST-P; Gstp2

uniprot entry name :

GSTP1_RAT

host :

E Coli or Yeast or Baculovirus or Mammalian Cell

sequence positions :

2-210

sequence length :

210

sequence :

PPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWL
QGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGL
YGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDD
YVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLL
DLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSS
PDHLNRPINGNGKQ

purity :

Greater than 90% as determined by SDS-PAGE.

form :

Liquid containing glycerol; lyophilization may be available upon request.

storage stability :

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

products description :

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration.

products references :

Cloning and the nucleotide sequence of rat glutathione S-transferase P cDNA.Suguoka Y., Kano T., Okuda A., Sakai M., Kitagawa T., Muramatsu M.Nucleic Acids Res. 13:6049-6057(1985) The structure of the rat glutathione S-transferase P gene and related pseudogenes.Okuda A., Sakai M., Muramatsu M.J. Biol. Chem. 262:3858-3863(1987) Purification and characterization of P-52 (glutathione S-transferase-P or 7-7) from normal liver and putative preneoplastic liver nodules.Rushmore T.H., Harris L., Nagai M., Sharma R.N., Hayes M.A., Cameron R.G., Murray R.K., Farber E.Cancer Res. 48:2805-2812(1988) Lubec G., Afjehi-Sadat L., Chen W.-Q.Submitted (JAN-2009) to UniProtKB Identification of three classes of cytosolic glutathione transferase common to several mammalian species correlation between structural data and enzymatic properties.Mannervik B., Alin P., Guthenberg C., Jensson H., Tahir M.K., Warholm M., Joernvall H.Proc. Natl. Acad. Sci. U.S.A. 82:7202-7206(1985)

ncbi gi num :

25453420

ncbi acc num :

NP_036709.1

ncbi gb acc num :

NM_012577.2

uniprot acc num :

P04906

ncbi mol weight :

27.4kD

ncbi pathways :

Biological Oxidations Pathway (1333500); Cellular Responses To Stress Pathway (1333252); Chemical Carcinogenesis Pathway (673233); Chemical Carcinogenesis Pathway (673237); Detoxification Of Reactive Oxygen Species Pathway (1333258); Diurnally Regulated Genes With Circadian Orthologs Pathway (198473); Drug Metabolism - Cytochrome P450 Pathway (83424); Drug Metabolism - Cytochrome P450 Pathway (427); Glutathione Conjugation Pathway (1333524); Glutathione Metabolism Pathway (83365)

ncbi summary :

may play a role in drug and xenobiotic metabolism [RGD, Feb 2006]

uniprot summary :

GSTP1: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. Homodimer. Interacts with CDK5. Belongs to the GST superfamily. Pi family. Protein type: EC 2.5.1.18; Other Amino Acids Metabolism - glutathione; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Xenobiotic Metabolism - metabolism by cytochrome P450; Transferase. Cellular Component: cytoplasm; cytosol; extracellular space; intracellular; mitochondrion; nucleus; plasma membrane; protein complex; vesicle. Molecular Function: drug binding; glutathione binding; glutathione transferase activity; JUN kinase binding; kinase regulator activity; protein kinase binding. Biological Process: cellular response to insulin stimulus; glutathione metabolic process; negative regulation of biosynthetic process; negative regulation of fibroblast proliferation; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of interleukin-1 beta production; negative regulation of JNK activity; negative regulation of MAP kinase activity; negative regulation of nitric-oxide synthase biosynthetic process; negative regulation of protein kinase activity; negative regulation of stress-activated MAPK cascade; negative regulation of tumor necrosis factor production; oligodendrocyte development; organ regeneration; positive regulation of superoxide release; regulation of stress-activated MAPK cascade; response to amino acid stimulus; response to estradiol stimulus; response to ethanol; response to L-ascorbic acid; response to nutrient levels; response to reactive oxygen species; response to toxin; xenobiotic metabolic process

size1 :

0.05 mg (E-Coli)

price1 :

190 USD

size2 :

0.2 mg (E-Coli)

price2 :

460

size3 :

0.5 mg (E-Coli)

price3 :

750

size4 :

0.05 mg (Baculovirus)

price4 :

960

size5 :

1 mg (E-Coli)

price5 :

1180

more info or order :

MyBioSource product webpage