protein

Recombinant Human Keratin, type II cytoskeletal 4

MBS717756

0.05 mg (E-Coli)

190 USD

Recombinant Protein

Recombinant Human Keratin, type II cytoskeletal 4

Keratin, type II cytoskeletal 4

Cytokeratin-4; CK-4; Keratin-4; K4; Type-II keratin Kb4

Keratin, type II cytoskeletal 4; Keratin, type II cytoskeletal 4; Cytokeratin-4; CK-4; Keratin-4; K4; Type-II keratin Kb4

KRT4

KRT4; CYK4; CK-4; K4

K2C4_HUMAN

E Coli or Yeast or Baculovirus or Mammalian Cell

1-534

534

MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGA
GRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAG
GFGTGGFGAGGFGAGFGTGGFGGGFGGSFSGKGGPGFPV
CPAGGIQEVTINQSLLTPLHVEIDPEIQKVRTEEREQIK
LLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQTTTTSS
KNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSV
EDFKTKYEEEINKRTAAENDF

Greater than 90% as determined by SDS-PAGE.

Liquid containing glycerol; lyophilization may be available upon request.

Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

Signal Transduction

A mutation detection strategy for oral mucosal keratins K4, K13, and K2p in white sponge nevus.Cassidy A.J., Morley S.M., McLean W.H.I.The finished DNA sequence of human chromosome 12.Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.Nature 440:346-351(2006) Allelic variations of human keratins K4 and K5 provide polymorphic markers within the type II keratin gene cluster on chromosome 12.Wanner R., Foerster H.-H., Tilmans I., Mischke D.J. Invest. Dermatol. 100:735-741(1993) Molecular characterization and expression of the stratification-related cytokeratins 4 and 15.Leube R.E., Bader B.L., Bosch F.X., Zimbelmann R., Achtstaetter T., Franke W.W.J. Cell Biol. 106:1249-1261(1988) Wanner R., Tilmans I., Mischke D.Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) A glutamine insertion in the 1A alpha helical domain of the keratin 4 gene in a familial case of white sponge nevus.Terrinoni A., Candi E., Oddi S., Gobello T., Camaione D.B., Mazzanti C., Zambruno G., Knight R., Melino G.J. Invest. Dermatol. 114:388-391(2000) A novel mutation in the keratin 4 gene causing white sponge naevus.Chao S.C., Tsai Y.M., Yang M.H., Lee Jy J.Y.Br. J. Dermatol. 148:1125-1128(2003)

82654947

P19013.4

P19013

73.2kD

K4: Heterotetramer of two type I and two type II keratins. Keratin-4 is generally associated with keratin-13. Detected in the suprabasal layer of the stratified epithelium of the esophagus, exocervix, vagina, mouth and lingual mucosa, and in cells and cell clusters in the mucosa and serous gland ducts of the esophageal submucosa. Expressed widely in the exocervix and esophageal epithelium, with lowest levels detected in the basal cell layer. Belongs to the intermediate filament family. Protein type: Cytoskeletal. Chromosomal Location of Human Ortholog: 12q13.13. Cellular Component: cell surface; intermediate filament; intermediate filament cytoskeleton; keratin filament; nucleus. Molecular Function: protein binding; structural molecule activity. Biological Process: cytoskeleton organization and biogenesis; epithelial cell differentiation; negative regulation of epithelial cell proliferation. Disease: White Sponge Nevus 1

0.05 mg (E-Coli)

190 USD

0.05 mg (Yeast)

190

0.2 mg (E-Coli)

460

0.2 mg (Yeast)

460

0.5 mg (Yeast)

750