product summary
Loading...
company name :
MyBioSource
product type :
protein
product name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-12 subunit beta (IL12B)
catalog :
MBS717660
quantity :
1 mg (E-Coli)
price :
1615 USD
more info or order :
MyBioSource product webpage
product information
catalog number :
MBS717660
products type :
Recombinant Protein
products full name :
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-12 subunit beta (IL12B)
products short name :
(Rhesus macaque) Interleukin-12 subunit beta (IL12B)
products name syn :
Recombinant (Rhesus macaque) Interleukin-12 subunit beta (IL12B); Interleukin-12 subunit beta; IL-12B; Cytotoxic lymphocyte maturation factor 40 kDa subunit; CLMF p40 IL-12 subunit p40
other names :
interleukin-12 subunit beta; Interleukin-12 subunit beta; interleukin-12 subunit beta; IL-12B; CLMF p40; IL-12 subunit p40; cytotoxic lymphocyte maturation factor 40 kDa subunit; Cytotoxic lymphocyte maturation factor 40 kDa subunit; CLMF p40; IL-12 subunit p40
products gene name syn :
IL12B
other gene names :
IL12B; IL12B; IL-12B; CLMF p40
uniprot entry name :
IL12B_MACMU
host :
E Coli or Yeast or Baculovirus or Mammalian Cell
sequence positions :
23-328
sequence length :
328
sequence :
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWT
LDQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHS
LLLLHKKEDGIWSTDVLKDQKEPKNKTFLRCEAKNYSGR
FTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAE
RVRGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHK
LKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSW
EYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTS
ATVICRKNASFSVQAQDRYYSSSWSEWASVPCS
purity :
>90%
form :
Liquid containing glycerol; lyophilization may be available upon request.
storage stability :
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
other info1 :
Species: Macaca mulatta (Rhesus macaque)
ncbi gi num :
113461943
ncbi acc num :
NP_001038190.1
ncbi gb acc num :
NM_001044725.1
uniprot acc num :
P48095
ncbi mol weight :
37,273 Da
ncbi pathways :
African Trypanosomiasis Pathway (194389); African Trypanosomiasis Pathway (194323); Allograft Rejection Pathway (86789); Allograft Rejection Pathway (535); Amoebiasis Pathway (167336); Amoebiasis Pathway (167191); Chagas Disease (American Trypanosomiasis) Pathway (147811); Chagas Disease (American Trypanosomiasis) Pathway (147795); Cytokine-cytokine Receptor Interaction Pathway (86721); Cytokine-cytokine Receptor Interaction Pathway (460)
uniprot summary :
Function: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC . By similarity.Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis . By similarity. Subunit structure: Heterodimer with IL12A; disulfide-linked. The heterodimer is known as interleukin IL-12. Heterodimer with IL23A; disulfide-linked. The heterodimer is known as interleukin IL-23. Also secreted as a monomer . By similarity. Subcellular location: Secreted. Sequence similarities: Belongs to the type I cytokine receptor family. Type 3 subfamily.Contains 1 fibronectin type-III domain.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
size1 :
1 mg (E-Coli)
price1 :
1615 USD
size2 :
1 mg (Yeast)
price2 :
2075
more info or order :
MyBioSource product webpage
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!